


| Basic Information | |
|---|---|
| Family ID | F092487 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSKVVTVGATALFACILCATPLSLRLSPEGKVTLSVDSASAE |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 86.92 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.551 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (11.215 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 14.29% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 10.28 |
| PF13787 | HXXEE | 5.61 |
| PF00839 | Cys_rich_FGFR | 4.67 |
| PF00196 | GerE | 3.74 |
| PF07784 | DUF1622 | 2.80 |
| PF07883 | Cupin_2 | 2.80 |
| PF03401 | TctC | 1.87 |
| PF07813 | LTXXQ | 1.87 |
| PF00119 | ATP-synt_A | 1.87 |
| PF00106 | adh_short | 0.93 |
| PF04392 | ABC_sub_bind | 0.93 |
| PF01979 | Amidohydro_1 | 0.93 |
| PF04226 | Transgly_assoc | 0.93 |
| PF00230 | MIP | 0.93 |
| PF00528 | BPD_transp_1 | 0.93 |
| PF01381 | HTH_3 | 0.93 |
| PF01594 | AI-2E_transport | 0.93 |
| PF12849 | PBP_like_2 | 0.93 |
| PF14534 | DUF4440 | 0.93 |
| PF00484 | Pro_CA | 0.93 |
| PF07244 | POTRA | 0.93 |
| PF02353 | CMAS | 0.93 |
| PF08734 | GYD | 0.93 |
| PF00361 | Proton_antipo_M | 0.93 |
| PF13442 | Cytochrome_CBB3 | 0.93 |
| PF13557 | Phenol_MetA_deg | 0.93 |
| PF00884 | Sulfatase | 0.93 |
| PF00346 | Complex1_49kDa | 0.93 |
| PF03952 | Enolase_N | 0.93 |
| PF09955 | DUF2189 | 0.93 |
| PF13185 | GAF_2 | 0.93 |
| PF12244 | DUF3606 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 7.48 |
| COG4828 | Uncharacterized membrane protein | Function unknown [S] | 2.80 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 1.87 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.87 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.93 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.93 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.93 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.93 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.93 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.93 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.93 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.55 % |
| Unclassified | root | N/A | 36.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111006|2214746118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 35-67-5 | 501 | Open in IMG/M |
| 3300000156|NODE_c0606719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1675 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100266289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1049359 | Not Available | 648 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10000092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 14495 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10037784 | Not Available | 1113 | Open in IMG/M |
| 3300001977|JGI24746J21847_1000023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14867 | Open in IMG/M |
| 3300001978|JGI24747J21853_1001981 | Not Available | 1608 | Open in IMG/M |
| 3300004463|Ga0063356_102574479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300005295|Ga0065707_10161155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1562 | Open in IMG/M |
| 3300005332|Ga0066388_105153506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300005345|Ga0070692_10666728 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005363|Ga0008090_15860627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 707 | Open in IMG/M |
| 3300005434|Ga0070709_10079417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2137 | Open in IMG/M |
| 3300005435|Ga0070714_100600522 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005455|Ga0070663_101444593 | Not Available | 610 | Open in IMG/M |
| 3300005530|Ga0070679_100215581 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300005535|Ga0070684_100177189 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300005543|Ga0070672_102039961 | Not Available | 517 | Open in IMG/M |
| 3300005546|Ga0070696_100241831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1362 | Open in IMG/M |
| 3300005617|Ga0068859_100305366 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300005713|Ga0066905_100008570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4673 | Open in IMG/M |
| 3300005713|Ga0066905_100337212 | Not Available | 1199 | Open in IMG/M |
| 3300005713|Ga0066905_100509353 | Not Available | 1002 | Open in IMG/M |
| 3300005713|Ga0066905_100823558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 807 | Open in IMG/M |
| 3300005713|Ga0066905_101035798 | Not Available | 725 | Open in IMG/M |
| 3300005764|Ga0066903_101247186 | Not Available | 1384 | Open in IMG/M |
| 3300005764|Ga0066903_103597006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 835 | Open in IMG/M |
| 3300005764|Ga0066903_106357608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300006048|Ga0075363_100922923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 535 | Open in IMG/M |
| 3300006175|Ga0070712_100566122 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006196|Ga0075422_10037227 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300006237|Ga0097621_100153662 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300006852|Ga0075433_10722956 | Not Available | 872 | Open in IMG/M |
| 3300006914|Ga0075436_100670907 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006914|Ga0075436_101157552 | Not Available | 583 | Open in IMG/M |
| 3300009098|Ga0105245_10190616 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300009101|Ga0105247_10126126 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300009148|Ga0105243_10398449 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300010362|Ga0126377_11318648 | Not Available | 794 | Open in IMG/M |
| 3300010366|Ga0126379_10067624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium aegyptiacum | 3031 | Open in IMG/M |
| 3300010373|Ga0134128_10407615 | Not Available | 1518 | Open in IMG/M |
| 3300010396|Ga0134126_11564220 | Not Available | 726 | Open in IMG/M |
| 3300010397|Ga0134124_10880491 | Not Available | 900 | Open in IMG/M |
| 3300010399|Ga0134127_12310545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300012948|Ga0126375_11254050 | Not Available | 620 | Open in IMG/M |
| 3300012961|Ga0164302_10828511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300012971|Ga0126369_10866207 | Not Available | 988 | Open in IMG/M |
| 3300012971|Ga0126369_11168024 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300013100|Ga0157373_10829645 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300015373|Ga0132257_102631911 | Not Available | 655 | Open in IMG/M |
| 3300016341|Ga0182035_11555523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 596 | Open in IMG/M |
| 3300016422|Ga0182039_10141379 | Not Available | 1849 | Open in IMG/M |
| 3300016445|Ga0182038_10006070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6583 | Open in IMG/M |
| 3300016445|Ga0182038_11725605 | Not Available | 564 | Open in IMG/M |
| 3300017792|Ga0163161_11412959 | Not Available | 608 | Open in IMG/M |
| 3300020078|Ga0206352_10898743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300021560|Ga0126371_12181487 | Not Available | 668 | Open in IMG/M |
| 3300022889|Ga0247785_1001150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2393 | Open in IMG/M |
| 3300022901|Ga0247788_1000256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6823 | Open in IMG/M |
| 3300025905|Ga0207685_10062441 | Not Available | 1480 | Open in IMG/M |
| 3300025917|Ga0207660_10317522 | Not Available | 1243 | Open in IMG/M |
| 3300025917|Ga0207660_10402417 | Not Available | 1103 | Open in IMG/M |
| 3300025920|Ga0207649_10262962 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300025921|Ga0207652_10403883 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300025921|Ga0207652_11319114 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae | 624 | Open in IMG/M |
| 3300025924|Ga0207694_11189019 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300025927|Ga0207687_10629475 | Not Available | 906 | Open in IMG/M |
| 3300025928|Ga0207700_10786636 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300025933|Ga0207706_10124741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2265 | Open in IMG/M |
| 3300025934|Ga0207686_10817161 | Not Available | 748 | Open in IMG/M |
| 3300025945|Ga0207679_11385517 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300026035|Ga0207703_10456951 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300026067|Ga0207678_10358898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300026067|Ga0207678_10473114 | Not Available | 1091 | Open in IMG/M |
| 3300026779|Ga0207471_102226 | Not Available | 688 | Open in IMG/M |
| 3300027035|Ga0207776_1012204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1240 | Open in IMG/M |
| 3300027063|Ga0207762_1034059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 769 | Open in IMG/M |
| 3300027433|Ga0207618_101987 | Not Available | 524 | Open in IMG/M |
| 3300027873|Ga0209814_10049640 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300027874|Ga0209465_10318602 | Not Available | 779 | Open in IMG/M |
| 3300027915|Ga0209069_10245083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300028379|Ga0268266_11327439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300028379|Ga0268266_11535554 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031545|Ga0318541_10274908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300031679|Ga0318561_10107115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1474 | Open in IMG/M |
| 3300031740|Ga0307468_100768344 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031795|Ga0318557_10545468 | Not Available | 532 | Open in IMG/M |
| 3300031897|Ga0318520_10893796 | Not Available | 559 | Open in IMG/M |
| 3300031897|Ga0318520_11108636 | Not Available | 502 | Open in IMG/M |
| 3300031912|Ga0306921_12657712 | Not Available | 516 | Open in IMG/M |
| 3300031941|Ga0310912_10104126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2096 | Open in IMG/M |
| 3300031947|Ga0310909_10228523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1551 | Open in IMG/M |
| 3300032001|Ga0306922_10333486 | Not Available | 1628 | Open in IMG/M |
| 3300032017|Ga0310899_10006978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3208 | Open in IMG/M |
| 3300032017|Ga0310899_10108513 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300032060|Ga0318505_10195520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 946 | Open in IMG/M |
| 3300032094|Ga0318540_10021379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2702 | Open in IMG/M |
| 3300032179|Ga0310889_10383246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300032180|Ga0307471_100672394 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300032205|Ga0307472_100271228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1345 | Open in IMG/M |
| 3300032261|Ga0306920_100030764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7655 | Open in IMG/M |
| 3300032828|Ga0335080_10218459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2091 | Open in IMG/M |
| 3300033289|Ga0310914_10351315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1333 | Open in IMG/M |
| 3300033433|Ga0326726_10930037 | Not Available | 844 | Open in IMG/M |
| 3300034817|Ga0373948_0029568 | Not Available | 1097 | Open in IMG/M |
| 3300034820|Ga0373959_0037248 | Not Available | 1007 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026779 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027433 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2213756254 | 2209111006 | Arabidopsis Rhizosphere | MSKAVTVGAAALLGCILCATPLSLHVSPEGRVSLS |
| NODE_06067191 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MSKVVTVGATTLFACILCATPLSVRFSPEGTVSLSVDSAA |
| INPhiseqgaiiFebDRAFT_1002662892 | 3300000364 | Soil | VSKAVIVGAAALFGCILCAMPLSLRHSPEGKVSLS |
| AF_2010_repII_A01DRAFT_10493591 | 3300000580 | Forest Soil | MSKAVTAGATALLGCILFATPVTLRLSPEGKVSLSMESVSAGEAGINRRAY |
| AF_2010_repII_A001DRAFT_100000921 | 3300000793 | Forest Soil | MSKTVTLGTTALFACILCATPLSLRLLPDGKMSLSVDSASAVIGRPLTPMSV |
| AF_2010_repII_A001DRAFT_100377841 | 3300000793 | Forest Soil | MSKAVTAGATALLGCILFATPVTLRLSPEGKVSLSMESAPAG |
| JGI24746J21847_100002316 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHNSASAEVGRPLTATSVA |
| JGI24747J21853_10019811 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHN |
| Ga0063356_1025744791 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLKAAAVGATALGACILCVAPLSLRLSPEGSVSLFVDSAAAEIG |
| Ga0065707_101611551 | 3300005295 | Switchgrass Rhizosphere | MSKLVTTGVTALFVCILCTTPLSLRFSPEGNVSLSEDNASAVIGRPLTPMSVA |
| Ga0066388_1051535061 | 3300005332 | Tropical Forest Soil | MSKAVTVGAIVLLGCILCATPLSLRHSPEGKVSLSMDSASAE |
| Ga0070692_106667281 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKAVTVCAAALLGCILCATPLSLHVSPEGVSLSTDSASAD |
| Ga0008090_158606271 | 3300005363 | Tropical Rainforest Soil | MSKAATVGTTALFACVLCATPLSLRLSPEGNLLLSTDTASAEIGRPLTP |
| Ga0070709_100794171 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKIVAVGATAVFACILCATPLSLRLSPQGNLALSSDSASAEIGR |
| Ga0070714_1006005223 | 3300005435 | Agricultural Soil | MSKVATVGATALFACILCATPLSVSLSPEGNVALSVDSASAVIGRPLTP |
| Ga0070663_1014445931 | 3300005455 | Corn Rhizosphere | MTKVTIGATAVFACILCATPLSVRFSPEGKVLLSADSANAVVYCQYV |
| Ga0070679_1002155811 | 3300005530 | Corn Rhizosphere | MTKITVGATVIFAGILCATPLSVRFAPDGKVLLSADSANAVVYC |
| Ga0070684_1001771891 | 3300005535 | Corn Rhizosphere | MSKLVTTGATALFVCILCATPLSLRLSPEGNVSVSEDTAS |
| Ga0070672_1020399611 | 3300005543 | Miscanthus Rhizosphere | LEVVMSKLVTTGATALFVCILCATPLSLRLSPEGNVS |
| Ga0070696_1002418311 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKAAAVGATALGACILCVAPLSLRLSPEGSVSLFVDSAA |
| Ga0068859_1003053664 | 3300005617 | Switchgrass Rhizosphere | MSKLVTTGATALFACILCATPLSLRLSPEGNVSVSEDTA |
| Ga0066905_1000085708 | 3300005713 | Tropical Forest Soil | MSKVVIVGATALFACVLCAMPLSLRFSPEGNVSLSVDSAAAVI |
| Ga0066905_1003372121 | 3300005713 | Tropical Forest Soil | MSKAVTAGAITLLGCILCATPVTLRLSPEGKVSLSIESASAVDAGVNRRA |
| Ga0066905_1005093531 | 3300005713 | Tropical Forest Soil | MSKAVTAGATALLGCILCATPVTLRLSPEGKVSLSIESASAVDAGVNRRA |
| Ga0066905_1008235582 | 3300005713 | Tropical Forest Soil | MSKAITAGATALFACVLCATPLSLRLLPDGKMSLSVDSASAVIGRPLTPMSVA |
| Ga0066905_1010357982 | 3300005713 | Tropical Forest Soil | MSKAVTAGATALLGCILCATPVTLGLSPEGKVLLSI |
| Ga0066903_1012471861 | 3300005764 | Tropical Forest Soil | MSKVVKVGATALFACILCASPLSLRLSPEGIVALSVDSASAVIGRPLTP |
| Ga0066903_1035970061 | 3300005764 | Tropical Forest Soil | MSKVLTVGATALFACTLCATPLSLRLSPEGNLSLSVDSASAVIGRPLTP |
| Ga0066903_1063576083 | 3300005764 | Tropical Forest Soil | MSKAVTVGATALLGCILCATPLSLRLSPEGKVSLF |
| Ga0075363_1009229232 | 3300006048 | Populus Endosphere | MLKAAAVGATALGACILCVAPLSLRLSPEGSVSLFVDSAAAEIGRPLTAGSV |
| Ga0070712_1005661221 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKVVTVGATALFACFLCATPLSVRLLPEGIAALS |
| Ga0075422_100372274 | 3300006196 | Populus Rhizosphere | MSKVVTVGATAVFACILCATPLSLRLSPEGNVALSMDSASARI |
| Ga0097621_1001536621 | 3300006237 | Miscanthus Rhizosphere | MLKPVTVGATAFLGRILCATPVTLRLSPEGKISMSMESTSAVEAGV |
| Ga0075433_107229562 | 3300006852 | Populus Rhizosphere | MSKVVTVGATAVFACILCATPLSLRLSPEGNVALSMD |
| Ga0075436_1006709071 | 3300006914 | Populus Rhizosphere | MSKAVTAGATALLGCILCATPVTLRLSPEGKVSLSMESASAVDAG |
| Ga0075436_1011575521 | 3300006914 | Populus Rhizosphere | MSKLVTVGATALFACVLCATPYSLRFSPDGKMSLSTDTASAVIG |
| Ga0105245_101906165 | 3300009098 | Miscanthus Rhizosphere | MSKVVTVGATALFACILCATPLALRLSPEGNVVLSVDSASAVIGR |
| Ga0105247_101261261 | 3300009101 | Switchgrass Rhizosphere | MSKLVRTGATALFVCILCATPLSLRLASEGNVSVSEDTAS |
| Ga0105243_103984493 | 3300009148 | Miscanthus Rhizosphere | MSKLVTTGATALFACILCATPLSLRLSPEGNVSVSEDTAS |
| Ga0126377_113186482 | 3300010362 | Tropical Forest Soil | MSKAITAGATALFACVLCATPLSLRLLPDGKMSLSTDTASAVIGR |
| Ga0126379_100676242 | 3300010366 | Tropical Forest Soil | MSKAVTVGATAFLACVLWGTPLSLRLSPEGKVSLSMDGAQRRPRE* |
| Ga0134128_104076152 | 3300010373 | Terrestrial Soil | MSKVITVGATVLFAGILCATPLSVRLSPQGTVALFADGASAEIG |
| Ga0134126_115642201 | 3300010396 | Terrestrial Soil | MSKLVTTGATALFACILCATPLSLRLSPEGNVSVSEDTASAVIGRP |
| Ga0134124_108804911 | 3300010397 | Terrestrial Soil | MSKLVTTGATALFVCILCATPLSLRLSPEGNVSVSEDT |
| Ga0134127_123105452 | 3300010399 | Terrestrial Soil | MLKAAAVGATALGACILCVAPLSLRLSPEGSVSLFVDSA |
| Ga0126375_112540502 | 3300012948 | Tropical Forest Soil | MSKAVTAGATALLGCILCATPVTLRLSPEGKVSLFMESASAVDAGVNRRT |
| Ga0164302_108285111 | 3300012961 | Soil | MSKLVTTGVTALFVCILCTTPLSLRFSPEGNVSLSEDTASAVI |
| Ga0126369_108662072 | 3300012971 | Tropical Forest Soil | MSKLVTVGASALFACILCATPFSLRFSPEGNVSLSTD |
| Ga0126369_111680242 | 3300012971 | Tropical Forest Soil | MSKVVTVGATALFACILCATPLSFRVSPLGHVALSVD |
| Ga0157373_108296452 | 3300013100 | Corn Rhizosphere | MSKLVTTGATALFVCILCAIPLSLRLSPEGNVSVSEDTASAVIGRPLTP |
| Ga0132257_1026319111 | 3300015373 | Arabidopsis Rhizosphere | MSKVVTVGATVVFACILCATPLSLRLSGGAMALSEDNASAE |
| Ga0182035_115555231 | 3300016341 | Soil | MSKAVTVGTTALFACVLFATPLSLRLSPEGNLLPSTDTA |
| Ga0182039_101413791 | 3300016422 | Soil | MSKAVTAGATALLGCILFATPVTLRLSPEGKVSPSMESASADAGLN |
| Ga0182038_100060708 | 3300016445 | Soil | MSKAVSVGATAFLACVLWATPLSLRLSPEGKVSLS |
| Ga0182038_117256052 | 3300016445 | Soil | MPKLMTVGATALFACVLCATPLSLRLLPDGKMSLSTDTASAVIGRPL |
| Ga0163161_114129591 | 3300017792 | Switchgrass Rhizosphere | MSKLVTTGATALFVCILCATPLSLRLSPEGNVSVSEDTASAV |
| Ga0206352_108987432 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKAAAVGATALGACILCVAPLSLRLSPEGSVSLFVDSAAAEIGRPLTAG |
| Ga0126371_121814871 | 3300021560 | Tropical Forest Soil | MSKAVTAGATALLGCILFATPVTLRLSPEGKVSLSMESASAGDAG |
| Ga0247785_10011506 | 3300022889 | Soil | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHNSASAEVGRPLTAASVA |
| Ga0247788_10002561 | 3300022901 | Soil | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHNSASAEVGRPLTATSV |
| Ga0207685_100624411 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKVATVGATALFACILCATPLSVSLSPEGNVALSVDTASAVIGRP |
| Ga0207660_103175221 | 3300025917 | Corn Rhizosphere | MTKVTIGATAVFACILCATPLSVRFSPEGKVLLSADSANAVVYCQYVG |
| Ga0207660_104024173 | 3300025917 | Corn Rhizosphere | MSKVATVGATALFACILCATPLSVSLSPEGNVALSVDTASAVIGRPLT |
| Ga0207649_102629624 | 3300025920 | Corn Rhizosphere | MSKAVTVGAAALLGCILCATPLSLHVSSEGVSLSADSASADG |
| Ga0207652_104038831 | 3300025921 | Corn Rhizosphere | MSKVVTVGATALFACIVCATPLSVRLLPAGIAALSVDSASAEIG |
| Ga0207652_113191141 | 3300025921 | Corn Rhizosphere | MSKASVAATAVLACILCATPLSVRFAPEGKVLLSADSAN |
| Ga0207694_111890191 | 3300025924 | Corn Rhizosphere | MSKAVTVGAAALLGCILCATPLSLHVSSEGVSLSA |
| Ga0207687_106294752 | 3300025927 | Miscanthus Rhizosphere | MSKVVTVGATALFACILCATPLSLRLSPEGKVTLSVDSASAE |
| Ga0207700_107866363 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKVVTVGVTGFFACILCATPLSLRLSPEGNVALSVD |
| Ga0207706_101247411 | 3300025933 | Corn Rhizosphere | MSKAVTVGAAALLGCILCATPLSLHVSPEGRVSLSTDSASAD |
| Ga0207686_108171611 | 3300025934 | Miscanthus Rhizosphere | MSKLVTTGATALFACILCATPLSLRLSPEGNVSVSEDT |
| Ga0207679_113855172 | 3300025945 | Corn Rhizosphere | MSKAVTVGAAALLGCILCATPLSLHVSPEGVSLST |
| Ga0207703_104569513 | 3300026035 | Switchgrass Rhizosphere | MSKVVTVGATALFACILCATPLSLRLSPEGNVVLSVDS |
| Ga0207678_103588981 | 3300026067 | Corn Rhizosphere | MSKVVTVGATALFACILCATPLSLRLSPEGKVTLSVDSASAEIG |
| Ga0207678_104731142 | 3300026067 | Corn Rhizosphere | MSKLVTTGATALFVCILCATPLSLRLSPEGNVSVSEDTASAVI |
| Ga0207471_1022261 | 3300026779 | Soil | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHNSASAEVG |
| Ga0207776_10122041 | 3300027035 | Tropical Forest Soil | MSKIVTVGATALFACVLCATPLSLRLLPDGNVSLSVDSASAEIGRP |
| Ga0207762_10340592 | 3300027063 | Tropical Forest Soil | MSKIVTAGATALFACVLCATPLSLRLSPQGNLSLSVDSASAEVGRPL |
| Ga0207618_1019871 | 3300027433 | Soil | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTH |
| Ga0209814_100496401 | 3300027873 | Populus Rhizosphere | MSKVVTVGATAVFACILCATPLSLRLSPEGNVALSMDSASARIGR |
| Ga0209465_103186022 | 3300027874 | Tropical Forest Soil | MSKTVTLGTTALFACILCATPLSLRLLPEGKVSLSADTA |
| Ga0209069_102450832 | 3300027915 | Watersheds | MSKVVTVGATALFACILCATPLSLRLLPEGNVALSVDSASAVIG |
| Ga0268266_113274391 | 3300028379 | Switchgrass Rhizosphere | MSKIVAVGATAVFACILCATPLSLRLSPHGNVALSS |
| Ga0268266_115355541 | 3300028379 | Switchgrass Rhizosphere | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHNSASAEVGRPLTAAS |
| Ga0318541_102749081 | 3300031545 | Soil | MSKAVTVGTTALFACVLFATPLSLRLSPEGNLLPSTDTASAEIG |
| Ga0318561_101071154 | 3300031679 | Soil | MSKAVSVGATAFLACVLWATPLSLRLSPEGKVSLSMDRASAQT |
| Ga0307468_1007683442 | 3300031740 | Hardwood Forest Soil | MSKAVTVGAAALLGCILCATPLSLHVSPEGVSLSTDSASADGV |
| Ga0318557_105454681 | 3300031795 | Soil | MSKLVTVGATALFACILCTTPYSVRFSPEGNLSLSTDTAS |
| Ga0318520_108937961 | 3300031897 | Soil | MSKLVTTGATALFACILFATPFSLRFSPEGNVSLSTDTASAVIGRPLTPMS |
| Ga0318520_111086361 | 3300031897 | Soil | MSKLVTVGTTALFACILSAAPLSFHLSRSSNVTLST |
| Ga0306921_126577121 | 3300031912 | Soil | MSKVITVGATAVFACVLCATPLSLRFSPEGNVALSGDSASARIGHPLTAT |
| Ga0310912_101041265 | 3300031941 | Soil | MSKLVTVGTTALFACILSATPLSVHLSRSGNVTLSTDTASAVI |
| Ga0310909_102285233 | 3300031947 | Soil | MSKAVSVGATAFLACVLWATPLSLRLSPEGKVSLSM |
| Ga0306922_103334865 | 3300032001 | Soil | MSKAVTAGATALLGCILFATPVTLRLSPEGKVSLSMESV |
| Ga0310899_100069785 | 3300032017 | Soil | MSKLVTTGATALFVCILCATPLSLRLSSEGNVSVSEDTASAVIGR |
| Ga0310899_101085131 | 3300032017 | Soil | MSKMLTVGATALFAGILCATPFSVRLSPQGTVTLSADGASAEIGRPLTAGSV |
| Ga0318505_101955203 | 3300032060 | Soil | MSKAVSVGATAFLACVLWATPLSLRLSPEGKVSLSMD |
| Ga0318540_100213794 | 3300032094 | Soil | MSKAVTAGATALLGCILFATPVTLRLSPEGKVSPSM |
| Ga0310889_103832461 | 3300032179 | Soil | MSKIVAVGATAVFACILCATPLSLRLSPQGNVALST |
| Ga0307471_1006723941 | 3300032180 | Hardwood Forest Soil | MSKAVTVGAAALLGCILCSTPLSLHVSSEGVSLSADSASADG |
| Ga0307472_1002712283 | 3300032205 | Hardwood Forest Soil | MSKVSAVGATAVFACILCATPASLRLSPEGNVSLTQNSASAEVGRQLTAT |
| Ga0306920_1000307641 | 3300032261 | Soil | MSKAVSVGATAFLACVLWATPLSLRLSPEGKVSLSLDRASAQ |
| Ga0335080_102184591 | 3300032828 | Soil | MSKVVTVGATALCACILCATPLSLRVSPLGHVALSVDSASA |
| Ga0310914_103513154 | 3300033289 | Soil | MSKLVTVGTTALFACILSAAPLSFHLSRSGNVTLSTDTASAVIGRPLTPM |
| Ga0326726_109300371 | 3300033433 | Peat Soil | MSKVVTVGATSLFACILCATPLSLRLLPEGNVALSVDSASAVI |
| Ga0373948_0029568_950_1096 | 3300034817 | Rhizosphere Soil | MSKSVTVGTTAFFACILCATPVSLGVSPQGNVSLTHNSASAEVGRPLTA |
| Ga0373959_0037248_853_1005 | 3300034820 | Rhizosphere Soil | MSKLVTTGATALFVCILCATPLSLRLSSEGNVSVSEDTASAVIGRPLTPMS |
| ⦗Top⦘ |