


| Basic Information | |
|---|---|
| Family ID | F092426 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 39 residues |
| Representative Sequence | QNGTSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 90.65 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.981 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (6.542 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.449 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.664 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 9.35 |
| PF01436 | NHL | 2.80 |
| PF13548 | DUF4126 | 2.80 |
| PF13360 | PQQ_2 | 1.87 |
| PF03450 | CO_deh_flav_C | 1.87 |
| PF03401 | TctC | 0.93 |
| PF00989 | PAS | 0.93 |
| PF04199 | Cyclase | 0.93 |
| PF08281 | Sigma70_r4_2 | 0.93 |
| PF12680 | SnoaL_2 | 0.93 |
| PF11412 | DsbC | 0.93 |
| PF00440 | TetR_N | 0.93 |
| PF13472 | Lipase_GDSL_2 | 0.93 |
| PF01738 | DLH | 0.93 |
| PF01416 | PseudoU_synth_1 | 0.93 |
| PF12616 | DUF3775 | 0.93 |
| PF01609 | DDE_Tnp_1 | 0.93 |
| PF01435 | Peptidase_M48 | 0.93 |
| PF02371 | Transposase_20 | 0.93 |
| PF08327 | AHSA1 | 0.93 |
| PF13415 | Kelch_3 | 0.93 |
| PF04203 | Sortase | 0.93 |
| PF11455 | MazE-like | 0.93 |
| PF13460 | NAD_binding_10 | 0.93 |
| PF14312 | FG-GAP_2 | 0.93 |
| PF04909 | Amidohydro_2 | 0.93 |
| PF02321 | OEP | 0.93 |
| PF02738 | MoCoBD_1 | 0.93 |
| PF02678 | Pirin | 0.93 |
| PF13531 | SBP_bac_11 | 0.93 |
| PF00254 | FKBP_C | 0.93 |
| PF13442 | Cytochrome_CBB3 | 0.93 |
| PF00724 | Oxidored_FMN | 0.93 |
| PF13343 | SBP_bac_6 | 0.93 |
| PF10518 | TAT_signal | 0.93 |
| PF09587 | PGA_cap | 0.93 |
| PF00300 | His_Phos_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.93 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.93 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.93 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.93 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.93 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.93 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.93 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.92 % |
| Unclassified | root | N/A | 13.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10085849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300005177|Ga0066690_10267687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1149 | Open in IMG/M |
| 3300005331|Ga0070670_101732455 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005459|Ga0068867_100840619 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005538|Ga0070731_10214017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
| 3300005541|Ga0070733_10406832 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300005548|Ga0070665_100770905 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005555|Ga0066692_10783828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005559|Ga0066700_11122068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300005563|Ga0068855_100346647 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300005719|Ga0068861_100113595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2173 | Open in IMG/M |
| 3300005836|Ga0074470_11081368 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005844|Ga0068862_101328165 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300006176|Ga0070765_100353022 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300006237|Ga0097621_100008089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7554 | Open in IMG/M |
| 3300006800|Ga0066660_10044830 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
| 3300006854|Ga0075425_102182665 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006903|Ga0075426_11290416 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300007004|Ga0079218_13648011 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009012|Ga0066710_101274949 | Not Available | 1139 | Open in IMG/M |
| 3300009089|Ga0099828_11710617 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009090|Ga0099827_11609218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300009093|Ga0105240_10006166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 17670 | Open in IMG/M |
| 3300009094|Ga0111539_11876834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300009098|Ga0105245_10855823 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009148|Ga0105243_12395261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300009177|Ga0105248_10073190 | All Organisms → cellular organisms → Bacteria | 3851 | Open in IMG/M |
| 3300009545|Ga0105237_10257110 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300009678|Ga0105252_10109579 | Not Available | 1116 | Open in IMG/M |
| 3300009777|Ga0105164_10678928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300010043|Ga0126380_11792536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 555 | Open in IMG/M |
| 3300010047|Ga0126382_11208060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300010154|Ga0127503_10974017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300010333|Ga0134080_10574026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300010343|Ga0074044_10970465 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010362|Ga0126377_10133343 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
| 3300010366|Ga0126379_13888028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300010379|Ga0136449_103665931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300010398|Ga0126383_12908797 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010400|Ga0134122_13355911 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010401|Ga0134121_11218161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300010401|Ga0134121_11975106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300011119|Ga0105246_11811248 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300011120|Ga0150983_12901232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300012200|Ga0137382_10881690 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012201|Ga0137365_10216980 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300012923|Ga0137359_11015873 | Not Available | 711 | Open in IMG/M |
| 3300012925|Ga0137419_10762912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300012925|Ga0137419_11872301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 514 | Open in IMG/M |
| 3300012972|Ga0134077_10360640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300013297|Ga0157378_10015235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6733 | Open in IMG/M |
| 3300013297|Ga0157378_11314963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300014167|Ga0181528_10898114 | Not Available | 501 | Open in IMG/M |
| 3300014745|Ga0157377_11400944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300014969|Ga0157376_10854570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300014969|Ga0157376_11737234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300015371|Ga0132258_12617293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300015373|Ga0132257_103083819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300015374|Ga0132255_101387070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300015374|Ga0132255_103637141 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300015374|Ga0132255_104269956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300016387|Ga0182040_10140927 | Not Available | 1704 | Open in IMG/M |
| 3300016387|Ga0182040_10517721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300018000|Ga0184604_10121073 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300018037|Ga0187883_10660045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300018433|Ga0066667_10553176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300018466|Ga0190268_12350008 | Not Available | 504 | Open in IMG/M |
| 3300018481|Ga0190271_13884859 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300020580|Ga0210403_11393825 | Not Available | 531 | Open in IMG/M |
| 3300022718|Ga0242675_1106369 | Not Available | 546 | Open in IMG/M |
| 3300025907|Ga0207645_10903165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300025912|Ga0207707_10200648 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300025912|Ga0207707_10823646 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300025924|Ga0207694_11113756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300025927|Ga0207687_11183021 | Not Available | 657 | Open in IMG/M |
| 3300025939|Ga0207665_10261454 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300025949|Ga0207667_10570776 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300026023|Ga0207677_11050752 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026067|Ga0207678_10019942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 5892 | Open in IMG/M |
| 3300026089|Ga0207648_10581557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1031 | Open in IMG/M |
| 3300026116|Ga0207674_11272031 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026121|Ga0207683_11967859 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300026142|Ga0207698_12231498 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026532|Ga0209160_1103331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300027682|Ga0209971_1127114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions | 627 | Open in IMG/M |
| 3300027842|Ga0209580_10399360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300027876|Ga0209974_10086416 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300027911|Ga0209698_11270018 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300028800|Ga0265338_11028674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300028906|Ga0308309_11363466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300029943|Ga0311340_11130837 | Not Available | 635 | Open in IMG/M |
| 3300031421|Ga0308194_10103906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300031525|Ga0302326_10161317 | All Organisms → cellular organisms → Bacteria | 3833 | Open in IMG/M |
| 3300031525|Ga0302326_12142716 | Not Available | 716 | Open in IMG/M |
| 3300031708|Ga0310686_104297094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031720|Ga0307469_12230776 | Not Available | 533 | Open in IMG/M |
| 3300031724|Ga0318500_10710908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031788|Ga0302319_10251798 | Not Available | 2139 | Open in IMG/M |
| 3300031820|Ga0307473_11133742 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031912|Ga0306921_11931777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300031945|Ga0310913_10529205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300031962|Ga0307479_11048283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300031962|Ga0307479_11072114 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300032059|Ga0318533_10396314 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032060|Ga0318505_10569028 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 533 | Open in IMG/M |
| 3300032829|Ga0335070_11080676 | Not Available | 739 | Open in IMG/M |
| 3300032954|Ga0335083_10449227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp. | 1090 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.93% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100858491 | 3300000567 | Peatlands Soil | ARQLICIQNGSSDGTTVEPMKKVVANLSEDDIIAISAYLGSLPPK* |
| Ga0066690_102676871 | 3300005177 | Soil | ICMQNGASAGTAAALMKKVVANLSEDDIISISAYLGSLPPR* |
| Ga0070670_1017324551 | 3300005331 | Switchgrass Rhizosphere | VYLARQLIMMRNGSSAGQAAQLMQQVVARLSEDDIISISAYLGSLPPQ* |
| Ga0068867_1008406191 | 3300005459 | Miscanthus Rhizosphere | QLITMQNGTSAGANAALMKKPVAKLSEDDIIAISAYLGSLPPR* |
| Ga0070731_102140171 | 3300005538 | Surface Soil | ICIQNGSSAGAAVAPMKKVVANLSEDDIIAISAYLGSLPPQ* |
| Ga0070733_104068323 | 3300005541 | Surface Soil | RQLICIQNGSSAGAAVAPMKKVVTNLSEDDIIAISAYLGSLSPR* |
| Ga0070665_1007709052 | 3300005548 | Switchgrass Rhizosphere | SAGANAALMKKAVAKLSEDDIISISAYLGSLPPR* |
| Ga0066692_107838282 | 3300005555 | Soil | LFDLQYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE* |
| Ga0066700_111220681 | 3300005559 | Soil | ARQLIGIQNGSSNGTAVALMKKPVAKLSEDDIISIAAYLGSLPPTTNH* |
| Ga0068855_1003466471 | 3300005563 | Corn Rhizosphere | TSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR* |
| Ga0068861_1001135954 | 3300005719 | Switchgrass Rhizosphere | YIARQLITMQNGTSAGANAVLMKKPVAKLSEDDIIAISAYLGSLPPR* |
| Ga0074470_110813681 | 3300005836 | Sediment (Intertidal) | GSSAGTAAGLMKKVVEKLSEDDIIAISAYVGSLPPQ* |
| Ga0068862_1013281652 | 3300005844 | Switchgrass Rhizosphere | TARQLFYMQHGSSAGKAVALMTRVVEKLSERDVIDISAYLGSLPPR* |
| Ga0070765_1003530221 | 3300006176 | Soil | SAGTAVALMKKVVSNLSEDDIISISAYLGSLPPQ* |
| Ga0097621_1000080891 | 3300006237 | Miscanthus Rhizosphere | SMENGSSAGTNSAPMKPVVAKLSEDDVIAISAYLGSLPPR* |
| Ga0066660_100448301 | 3300006800 | Soil | IARQLISMQNGSSAGTAVALMKKTVSNLSEDDTISISAYLGSLPP* |
| Ga0075425_1021826651 | 3300006854 | Populus Rhizosphere | YGSSAGKAAALMKAVVTNLSDEDIIAISAYVGSLPPQ* |
| Ga0075426_112904161 | 3300006903 | Populus Rhizosphere | SAGANAALMKKPLAKLTEDDIIAISAYLGSLSPR* |
| Ga0079218_136480111 | 3300007004 | Agricultural Soil | NGTSAGANAALMKKVVANLSEDEIIALSAYLGSLSPR* |
| Ga0066710_1012749491 | 3300009012 | Grasslands Soil | HGRSAGKAAELMKPVVASLSDDDIIAISSYLGSLPPQ |
| Ga0099828_117106172 | 3300009089 | Vadose Zone Soil | ITIQNGASAGTAVALMKKAVANLSEDDIISISAYLGSLAP* |
| Ga0099827_116092181 | 3300009090 | Vadose Zone Soil | MRYGSSAGKAAALMKAVVTNLAEDDIIAISAYVASLPPQ* |
| Ga0105240_100061661 | 3300009093 | Corn Rhizosphere | SAGTNAALMKKAVANLSEDDIIAISAYLGSLTPQ* |
| Ga0111539_118768341 | 3300009094 | Populus Rhizosphere | SAGKAAALMKKVVSNLSEDDIISISAYLGSLPPR* |
| Ga0105245_108558232 | 3300009098 | Miscanthus Rhizosphere | QNGSSAGTNAALMKKAVANLTEDDIISISAYLRTLSPQ* |
| Ga0105243_123952611 | 3300009148 | Miscanthus Rhizosphere | IQNGSSAGTAVALMKKAVANLSEDDIISISAYLGSLSPH* |
| Ga0105248_100731901 | 3300009177 | Switchgrass Rhizosphere | LITMQNGTSAGANAALMKKVVAKLSEDDIIALSAYVGSLPPK* |
| Ga0105237_102571101 | 3300009545 | Corn Rhizosphere | QLIQMQNGSSAGANAALMKKAVANLTEDDIISISAYLGTLTPQ* |
| Ga0105252_101095791 | 3300009678 | Soil | TSAGANAALMKKAVEKLSEDEIIALSAYLGSLPPR* |
| Ga0105164_106789282 | 3300009777 | Wastewater | IQNGSSAGTASALMKKAVANLSEDDIISISAYLGSLPPQ* |
| Ga0126380_117925362 | 3300010043 | Tropical Forest Soil | SSAGKAAELMKPVVANLSEDDIIAISSYLGSLPPQ* |
| Ga0126382_112080601 | 3300010047 | Tropical Forest Soil | SAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR* |
| Ga0127503_109740171 | 3300010154 | Soil | ARQLFDIQYGSSAGKAVALMKGPVAHLTEDDIIAISAYLGSLTP* |
| Ga0134080_105740261 | 3300010333 | Grasslands Soil | LMTMQNGTSAGANAALMKKPVSKLSEDDIISISAYLGSLPSQ* |
| Ga0074044_109704651 | 3300010343 | Bog Forest Soil | MDIQNGTSAGKAVALMKNVVAKLSEDEIIAISAYVGTLPPQ* |
| Ga0126377_101333431 | 3300010362 | Tropical Forest Soil | RSAGKAAELMKPVVASLSDDDIIAISSYLGSLPPQ* |
| Ga0126379_138880281 | 3300010366 | Tropical Forest Soil | SAGASSAPMQPTVAKLSEDDVIAISAYLGSLPPR* |
| Ga0136449_1036659311 | 3300010379 | Peatlands Soil | QLICMQNGSSAGTAAALMKKVVANLSEDDIIAISAYLGSLPPQ* |
| Ga0126383_129087971 | 3300010398 | Tropical Forest Soil | FQNNSRVGASSLLMKPVVAKLTEDDMIAISAYLGSLAE* |
| Ga0134122_133559111 | 3300010400 | Terrestrial Soil | ITMQNGTSAGANAALMKKPVSKLSEDDIIAISAYLGSLPPR* |
| Ga0134121_112181612 | 3300010401 | Terrestrial Soil | WLFDMRYGSSAGKAAALMKAVVTNLSEDDIIAISSYVASLPPQ* |
| Ga0134121_119751061 | 3300010401 | Terrestrial Soil | DIQYGSSNGKAVALMKGPVAKLKEDDIIAISAYLGSLRPE* |
| Ga0105246_118112481 | 3300011119 | Miscanthus Rhizosphere | QNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR* |
| Ga0150983_129012322 | 3300011120 | Forest Soil | QLFDIQYGSSAGKAVELMKGPVAHLTEDDIIAISAYLGSLVLE* |
| Ga0137382_108816901 | 3300012200 | Vadose Zone Soil | LICIQIGSSAGTAAALMKKVVSNLSEDDIIAISAYLGSLPPQ* |
| Ga0137365_102169802 | 3300012201 | Vadose Zone Soil | QNGTSAGANAALMKKVVVNLSEDDIIALSAYLGSLPPR* |
| Ga0137359_110158732 | 3300012923 | Vadose Zone Soil | SRGGKEVEPMKPVVANLSEDDIIAISSYLGSLPPA* |
| Ga0137419_107629121 | 3300012925 | Vadose Zone Soil | RQLICIQNGSSAGIAVALMKKAVSNLSEDDIISISAYLGSLPPQ* |
| Ga0137419_118723011 | 3300012925 | Vadose Zone Soil | SAGKAAALMKRAVASISEDDIIAISAYLGSLSPE* |
| Ga0134077_103606401 | 3300012972 | Grasslands Soil | GSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE* |
| Ga0157378_100152359 | 3300013297 | Miscanthus Rhizosphere | ICLQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR* |
| Ga0157378_113149633 | 3300013297 | Miscanthus Rhizosphere | QLFDLQYGSSAGKAAALMKRAVEHLSEDDIIAISAYLGSLAPR* |
| Ga0181528_108981141 | 3300014167 | Bog | QLICIQNGASAGVAVELMKKVVSNLSEDDIIAISAYLGTLPPK* |
| Ga0157377_114009442 | 3300014745 | Miscanthus Rhizosphere | QNGTSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR* |
| Ga0157376_108545701 | 3300014969 | Miscanthus Rhizosphere | QMQNGTSAGANAALMKKVVAKLTEDDIIAISAYLGSLPPR* |
| Ga0157376_117372341 | 3300014969 | Miscanthus Rhizosphere | LITMQNGTSAGANAALMKKVVAKLSEDDVIALSAYLGSLPPK* |
| Ga0132258_126172931 | 3300015371 | Arabidopsis Rhizosphere | SAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ* |
| Ga0132257_1030838192 | 3300015373 | Arabidopsis Rhizosphere | SAGANAALMNRVVAKLTEDDIISLAAYVGSLPPK* |
| Ga0132255_1013870701 | 3300015374 | Arabidopsis Rhizosphere | MQNGASAGTNAALMKKVVAKLSEEDIIAISAYLGSLPPR* |
| Ga0132255_1036371412 | 3300015374 | Arabidopsis Rhizosphere | LICMQNGTSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ* |
| Ga0132255_1042699562 | 3300015374 | Arabidopsis Rhizosphere | SAGKAAALMKAVVVNLTDDDIIAISAYVASLPPQ* |
| Ga0182040_101409272 | 3300016387 | Soil | GSSAGKAAEAMKPVVANLTEDDIIAISSYLGSLPPQ |
| Ga0182040_105177211 | 3300016387 | Soil | SSAGKAAALMKPVVANLSEDDIIAIASYLGSLPPQ |
| Ga0184604_101210731 | 3300018000 | Groundwater Sediment | RQLITMQNGTSAGANAALMKKPVSKLSEDDIIAISAYLGSLPPR |
| Ga0187883_106600451 | 3300018037 | Peatland | GSSAGVAVELMKKVVSDLSEDDIIAISAYLGSLPPR |
| Ga0066667_105531761 | 3300018433 | Grasslands Soil | TSAAAKATLMKKPVSKLSEDDIIWISAYLGSLPPE |
| Ga0190268_123500081 | 3300018466 | Soil | RQLITIQNGTNAGTAVALMKKVVAHLSEEDIISISAYLGSLPPQ |
| Ga0190271_138848591 | 3300018481 | Soil | NGSSAGTNSAPMKPAVANLSEDDVIAISAYLGSLPPR |
| Ga0210403_113938251 | 3300020580 | Soil | NGSRNGADDASMKKVVEKLSVDDIIAISAYLGSLPPQ |
| Ga0242675_11063692 | 3300022718 | Soil | SSAGKAAELIKPVVANLSEDDIIAISSYLGSLPPQ |
| Ga0207645_109031652 | 3300025907 | Miscanthus Rhizosphere | RQLFYMQHGSSAGKAVALMTRVVEKLSERDVIDISAYLGSLPPR |
| Ga0207707_102006482 | 3300025912 | Corn Rhizosphere | QLITMQNGTSAGANAALMKRVVAKLSEDDIISLSAYLGSLPPK |
| Ga0207707_108236462 | 3300025912 | Corn Rhizosphere | QLICLQNGTSAGANAALMKKAVAKLSEDDIISISAYLGSLPPR |
| Ga0207694_111137561 | 3300025924 | Corn Rhizosphere | LFDLQYGSSAGKAAALMKKTVTGLSEDDIINISAYLGSLPPQ |
| Ga0207687_111830211 | 3300025927 | Miscanthus Rhizosphere | FGSSAGKAAALMKAVVRNLSDDDIIALAAYVGSLPPQ |
| Ga0207665_102614543 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QLICLQNGSSAGTNAALMKKAVANLSEDDIIAISAYLGTLPPQ |
| Ga0207667_105707761 | 3300025949 | Corn Rhizosphere | GTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR |
| Ga0207677_110507522 | 3300026023 | Miscanthus Rhizosphere | LICLQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR |
| Ga0207678_100199426 | 3300026067 | Corn Rhizosphere | YTARQLFYMQHGSSAGKAVALMKGVVGKLSERDIIDISAYLGSLPPR |
| Ga0207648_105815571 | 3300026089 | Miscanthus Rhizosphere | ARQLISMQNGSSAGTNSTLMKPAVANLSEDDVIAIAAYLGSLPPR |
| Ga0207674_112720311 | 3300026116 | Corn Rhizosphere | TSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR |
| Ga0207683_119678591 | 3300026121 | Miscanthus Rhizosphere | SSAGKAAALMKAVVTNLSEDDIIAISAYVASLPPH |
| Ga0207698_122314982 | 3300026142 | Corn Rhizosphere | LICMQNGTSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ |
| Ga0209160_11033312 | 3300026532 | Soil | QNGASAGTAAALMKKVVANLSEDDIISISAYLGSLPPR |
| Ga0209971_11271141 | 3300027682 | Arabidopsis Thaliana Rhizosphere | YGSSAGKAAELMKAAVKNLSDDDIIAISSYLGSLPPQ |
| Ga0209580_103993601 | 3300027842 | Surface Soil | DMQYGSSSGKAAEPMKPVVANLKEDDIIAISAYLGSLPPQ |
| Ga0209974_100864162 | 3300027876 | Arabidopsis Thaliana Rhizosphere | LARQLISMQNGSSAGTNSTLMKPAVANLSEDDVIAIAAYLGSLPPR |
| Ga0209698_112700182 | 3300027911 | Watersheds | LSAGSASAPMKKVVANLSEDDIIAISAYLGSLPPQ |
| Ga0265338_110286741 | 3300028800 | Rhizosphere | GSSAGTAVALMKKPVAHLSEDDIIAISAYLGSLPPK |
| Ga0308309_113634662 | 3300028906 | Soil | SSAGKAAALMKAVVANLSEDDIIAISASVASLPPQ |
| Ga0311340_111308372 | 3300029943 | Palsa | LICMQNGSSAGKAAALMKKAVANLSEDDIIAISAYLGSLPPQ |
| Ga0308194_101039061 | 3300031421 | Soil | LFDLRYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE |
| Ga0302326_101613175 | 3300031525 | Palsa | QYGSSAGRAAALMKRAVANLSEDDIIAISAYLGSLPPQ |
| Ga0302326_121427162 | 3300031525 | Palsa | NGSSAGTAVALMKKAVAGLSEDDIIAISAYVGSLPPR |
| Ga0310686_1042970941 | 3300031708 | Soil | ARQLILMQNGSSAGTAAALMKKVVANLSEDDIIAISSYLGSLPPQ |
| Ga0307469_122307761 | 3300031720 | Hardwood Forest Soil | ASGGANAALMKKPVAKLTEEDIIAIAAYLGSLPPH |
| Ga0318500_107109081 | 3300031724 | Soil | LFDIQYGSSAGKAVALMKGPVAHLTEDDIIAISAYLGSLAPE |
| Ga0302319_102517983 | 3300031788 | Bog | DKQGLSGSASLLMQPVVAKLTMDDMIAISAYVASLPP |
| Ga0307473_111337422 | 3300031820 | Hardwood Forest Soil | SMQNGSSAGTNSALMKPAVANLSENDVIAIAAYLGSLPPR |
| Ga0306921_119317772 | 3300031912 | Soil | LFDMQYGSSAGAAAAAMKPVVANLNEDDIIAISSYLGSLPPK |
| Ga0310913_105292051 | 3300031945 | Soil | LQYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPR |
| Ga0307479_110482832 | 3300031962 | Hardwood Forest Soil | SSAGTAAALMKKVVANLSEDDIISISAYLGSLPPR |
| Ga0307479_110721141 | 3300031962 | Hardwood Forest Soil | GSSAGVNTALMKKAVANLTEDDIISISAYLGALAPQ |
| Ga0318533_103963142 | 3300032059 | Soil | TMQNGTSAGVNAALMKKVVANLSEDDVIALSAYLGSLPPR |
| Ga0318505_105690281 | 3300032060 | Soil | SRTGDAATPMKPVVANLSDEDIIAISSYLGSLSPS |
| Ga0335070_110806762 | 3300032829 | Soil | GMQKGSSAGSSSAPMKPVVAKLSEDDVIAISAYLGSLPPR |
| Ga0335083_104492273 | 3300032954 | Soil | ICIQNGSSAGTAVALMKKVVARLSEDDVIAISAYLGSLPPR |
| ⦗Top⦘ |