


| Basic Information | |
|---|---|
| Family ID | F092384 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDQRGYRGGLPRLPLLPLHDEQKKRLSEFLATLEPAAVRA |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 96.26 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.065 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (46.729 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.533 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF10079 | BshC | 74.77 |
| PF13620 | CarboxypepD_reg | 2.80 |
| PF00958 | GMP_synt_C | 0.93 |
| PF01894 | UPF0047 | 0.93 |
| PF09587 | PGA_cap | 0.93 |
| PF02786 | CPSase_L_D2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.93 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.07 % |
| Unclassified | root | N/A | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02HWPV3 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300002908|JGI25382J43887_10121880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1356 | Open in IMG/M |
| 3300005174|Ga0066680_10329932 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005174|Ga0066680_10405792 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005447|Ga0066689_10037908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae | 2512 | Open in IMG/M |
| 3300005447|Ga0066689_10600134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
| 3300005526|Ga0073909_10725696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005542|Ga0070732_10569259 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005554|Ga0066661_10153365 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300005555|Ga0066692_10665063 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005557|Ga0066704_10721993 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006059|Ga0075017_100889087 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300006176|Ga0070765_102005937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300006354|Ga0075021_11101119 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006755|Ga0079222_12101388 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006806|Ga0079220_10089194 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300006806|Ga0079220_11583785 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300007265|Ga0099794_10200925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300007265|Ga0099794_10220647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300007265|Ga0099794_10408373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300009012|Ga0066710_100083997 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300009089|Ga0099828_10900213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300009090|Ga0099827_10143644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1947 | Open in IMG/M |
| 3300009137|Ga0066709_103071664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300010048|Ga0126373_10270082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1682 | Open in IMG/M |
| 3300010048|Ga0126373_12458239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010325|Ga0134064_10217891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300010337|Ga0134062_10380206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300010366|Ga0126379_11046070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300010379|Ga0136449_104664626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300011269|Ga0137392_11112660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300011271|Ga0137393_10221716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
| 3300011444|Ga0137463_1074393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300012096|Ga0137389_10046244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3261 | Open in IMG/M |
| 3300012096|Ga0137389_10942593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300012096|Ga0137389_11110214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300012096|Ga0137389_11773248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 513 | Open in IMG/M |
| 3300012096|Ga0137389_11847039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300012189|Ga0137388_10835460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300012189|Ga0137388_10939587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300012189|Ga0137388_11316093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300012189|Ga0137388_11322871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012202|Ga0137363_11403179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300012202|Ga0137363_11482779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012202|Ga0137363_11716826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012203|Ga0137399_10474704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300012203|Ga0137399_10685333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300012203|Ga0137399_10976615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300012205|Ga0137362_10244081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300012205|Ga0137362_10888874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300012205|Ga0137362_11526502 | Not Available | 555 | Open in IMG/M |
| 3300012206|Ga0137380_11271475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012357|Ga0137384_11130804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012361|Ga0137360_10345767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300012361|Ga0137360_11384341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012362|Ga0137361_10518853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300012363|Ga0137390_11685908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012582|Ga0137358_10034674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3327 | Open in IMG/M |
| 3300012582|Ga0137358_11092246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300012685|Ga0137397_10643184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300012918|Ga0137396_10508435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300012925|Ga0137419_10534626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300012925|Ga0137419_10814396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300012927|Ga0137416_10741241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300012927|Ga0137416_11080273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300012929|Ga0137404_11376848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300012930|Ga0137407_10645623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300012957|Ga0164303_10656213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300015052|Ga0137411_1370528 | All Organisms → cellular organisms → Bacteria | 5518 | Open in IMG/M |
| 3300015193|Ga0167668_1105684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300015241|Ga0137418_10339869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300015245|Ga0137409_10170629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1977 | Open in IMG/M |
| 3300017973|Ga0187780_10446971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300020579|Ga0210407_10689576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300021168|Ga0210406_11055822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300021432|Ga0210384_11555318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300021559|Ga0210409_10424996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300024288|Ga0179589_10322106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300024330|Ga0137417_1260458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1615 | Open in IMG/M |
| 3300025912|Ga0207707_10842229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 761 | Open in IMG/M |
| 3300025939|Ga0207665_10732770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300025941|Ga0207711_10095023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2628 | Open in IMG/M |
| 3300026281|Ga0209863_10180805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300026306|Ga0209468_1197384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300026325|Ga0209152_10456341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300026482|Ga0257172_1104946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300026514|Ga0257168_1055164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300026557|Ga0179587_10760075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300027660|Ga0209736_1112934 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300027729|Ga0209248_10016402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2321 | Open in IMG/M |
| 3300027765|Ga0209073_10046317 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300027842|Ga0209580_10143511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300027862|Ga0209701_10081599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2038 | Open in IMG/M |
| 3300027862|Ga0209701_10308023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300027882|Ga0209590_10148801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
| 3300027894|Ga0209068_10971010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300028906|Ga0308309_10494164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300030054|Ga0302182_10480969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300030057|Ga0302176_10346662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300030617|Ga0311356_11684387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031754|Ga0307475_10409334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300031754|Ga0307475_10483647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300031823|Ga0307478_11064548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031947|Ga0310909_10498645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300031962|Ga0307479_10173123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2121 | Open in IMG/M |
| 3300031962|Ga0307479_10818816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300032205|Ga0307472_100317629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 46.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_08815120 | 2170459005 | Grass Soil | YAMDQRGYRGGVPRLPLQPLNDERKRRVSDLLGELEPATARA |
| JGI25382J43887_101218801 | 3300002908 | Grasslands Soil | MDQRGYRGGIPRLPLLPLHAEQKKRLTEFLLNLEPAAVRA* |
| Ga0066680_103299321 | 3300005174 | Soil | KLIVSEGGVAGVKFVMDQRGYRGGIPRLPLQPLSNEQKTRISDFLARLEPATARA* |
| Ga0066680_104057921 | 3300005174 | Soil | KLIVSEGGVAGVKFVMDQRGYRGGIPRLPLQPLSNEQKTRISEFVTHLEPATASA* |
| Ga0066689_100379081 | 3300005447 | Soil | MDQRGYSGGLPRLPLLPLHQEQKKRLNALLATLEPAAVRA* |
| Ga0066689_106001341 | 3300005447 | Soil | SEMGIAGLKYIMDQRGYRGGIPRLPLRPLQNEQKKRLSEFLAILEPIAVRA* |
| Ga0073909_107256963 | 3300005526 | Surface Soil | PGVKFVMDQRGYRGGAPRSPLLPLTDAAKRRVLELLAAFEPAAARA* |
| Ga0070732_105692592 | 3300005542 | Surface Soil | MDQRGYHGGAPRLPLLPLADAAKRRVLELLATFEPIAARA* |
| Ga0066661_101533651 | 3300005554 | Soil | KYSMDQRGYRGGIPRPPLLPLHHEQKKRLTEFLTTLEPAAVRR* |
| Ga0066692_106650631 | 3300005555 | Soil | GGVAGVKFVMDQRGYRGGIPRLPLQPLSNEQKTRISEFVTHLEPATASA* |
| Ga0066704_107219931 | 3300005557 | Soil | SKLIVSEGGVAGVKFVMDQRGYRGGIPRLPLQPLSNEQKTRISEFVTHLEPATASA* |
| Ga0075017_1008890872 | 3300006059 | Watersheds | FVMDQRGYRGGAPRSPLLPLSDAARRRVSALLATFEPVAARA* |
| Ga0070765_1020059372 | 3300006176 | Soil | YRGGIPRLPLLPLHDEQKKRVNELLAGLEPAAMRA* |
| Ga0075021_111011192 | 3300006354 | Watersheds | VKHAMDQRGYRGGIPRLPLQPLHHEQKKRLTELLATLEPAAVRA* |
| Ga0079222_121013881 | 3300006755 | Agricultural Soil | DQRGYRGGLPRPPLLPIPEALKHKLVELLAAVEPVAARA* |
| Ga0079220_100891942 | 3300006806 | Agricultural Soil | MDQRGYRGGVPRLPLLPLQEEQKKRITALLETFEPAAMRA* |
| Ga0079220_115837852 | 3300006806 | Agricultural Soil | GVKYVMDQRGYRGGVPRLPLLPLKDEQKKRLKAFVETLEPAAMRA* |
| Ga0099794_102009251 | 3300007265 | Vadose Zone Soil | MDQRGYRGGLPRLPLLPLHDEQKKRLSEFLATLEPAAVRA* |
| Ga0099794_102206472 | 3300007265 | Vadose Zone Soil | GLKHVMDLRGYRGGLPRLPLLPLQPEQKTRLSEFIATLEPAVARA* |
| Ga0099794_104083732 | 3300007265 | Vadose Zone Soil | GIPGVKFVMDQRGYHGGIPRLPLQPLSEAAKQRVLELLATFDPIAARA* |
| Ga0066710_1000839973 | 3300009012 | Grasslands Soil | MGIAGLKYVMDQRGYRGGIPRLPLRPLQNEQKKRLSEFLAILEPIAVRA |
| Ga0099828_109002131 | 3300009089 | Vadose Zone Soil | HGGAPRLPLLPLSDAAKRRVLDVVAAFEPAAARA* |
| Ga0099827_101436443 | 3300009090 | Vadose Zone Soil | GLKYIMDQRGYRGGIPRLPLRPLQNEQKKRLSEFLAVLEPIAVRA* |
| Ga0066709_1030716641 | 3300009137 | Grasslands Soil | AMDQRGYRGGNPRLPLLPLHSEQKKRLTELLQTLEPAAVRA* |
| Ga0126373_102700821 | 3300010048 | Tropical Forest Soil | DQRGYRGGLPRLPLLPLHDEQKKRLNALLETFEAAAMRA* |
| Ga0126373_124582391 | 3300010048 | Tropical Forest Soil | GIPAVKFVMDHRGYKGGVPRLPIPALHEEQKKRLMELLGTLEPAAARV* |
| Ga0134064_102178911 | 3300010325 | Grasslands Soil | AGVKYAMDQRGYRGGIPRLPLLPLHAEQKKRLTEFLLNLEPAAVRA* |
| Ga0134062_103802062 | 3300010337 | Grasslands Soil | AMDQRGYRGALPRLPLLPLHDEQKKRLIEFLRTLEPAAVRA* |
| Ga0126379_110460702 | 3300010366 | Tropical Forest Soil | AGIKFAMDQRGYRGGMPRLPLLPLADAAKPRILQSLAKLEEPLAARV* |
| Ga0136449_1046646262 | 3300010379 | Peatlands Soil | GVKYVMDQRGYRGGLPRLPLLPLSDSQKHRIDELLATLEPAAMRA* |
| Ga0137392_111126601 | 3300011269 | Vadose Zone Soil | QKNLLRASKLIVSELGIPGVKFVMDQRGYHGGIPRLPLQPLSDAAKRRVLELLAAFEPAAARA* |
| Ga0137393_102217161 | 3300011271 | Vadose Zone Soil | AMDQRGYRGGIPRLPLQPLSDERKAWISSLLADLEPAAARA* |
| Ga0137463_10743932 | 3300011444 | Soil | IAGLKHAMDQRGYRGGIPRLPLLPLHHEQKKRLNDFLATLEPAVVRA* |
| Ga0137389_100462441 | 3300012096 | Vadose Zone Soil | GYRGGIPRPPLLPLQHEQKKRLTEFLATLEPATARA* |
| Ga0137389_109425932 | 3300012096 | Vadose Zone Soil | YRGGIPRLPLQPLTDEEKRRISDFLAELEPATARA* |
| Ga0137389_111102141 | 3300012096 | Vadose Zone Soil | ELQKNLLRASKLIVSELGIPGVKFVMDQRGYHGGIPRLPLQPLSDAAKRRVLELLAAFEPAAARA* |
| Ga0137389_117732481 | 3300012096 | Vadose Zone Soil | KLIVSELGIPGVKFVMDQRGYHGGIPRLPLQPLSEAAKQRVLELLATFDPIAARA* |
| Ga0137389_118470392 | 3300012096 | Vadose Zone Soil | RGGIPRLPLFPLHQEQKKRLNDFLATLEPAAVRA* |
| Ga0137388_108354601 | 3300012189 | Vadose Zone Soil | IAGVKHAMDQRGYRGGIPRLPLLPLHHEQKKRLTEFLASLEPAAVRA* |
| Ga0137388_109395871 | 3300012189 | Vadose Zone Soil | QRGYRGGIPRPPLLPLHHEQKKRLTEFLITLEPATVRA* |
| Ga0137388_113160932 | 3300012189 | Vadose Zone Soil | VMDLRGYRGGLPRLPLLPLQPEQKTRLSEFIATLEPAVARA* |
| Ga0137388_113228711 | 3300012189 | Vadose Zone Soil | VKFVMDQRGYHGGIPRLPLQPLSEAAKRRVLELLVTFEPAAATA* |
| Ga0137363_114031791 | 3300012202 | Vadose Zone Soil | QRGYRGGIPRLPLRPLQNEQKKRLSEFLAILEPMAVRA* |
| Ga0137363_114827791 | 3300012202 | Vadose Zone Soil | AMDQRGYRGGIPRPPLLPLHHEQKKRLTEFLATLEPAVMRA* |
| Ga0137363_117168262 | 3300012202 | Vadose Zone Soil | VKFVMDQRGYRGGVPRSPLLPLSDAAKRRVLELLGTFEPAAARA* |
| Ga0137399_104747042 | 3300012203 | Vadose Zone Soil | AMDQRGYRGGVPRLPLLPLQHEQKKRLTEFLANLEPAAVRA* |
| Ga0137399_106853331 | 3300012203 | Vadose Zone Soil | VSEMGIAGVKFAMDQRGYRGGVPRLPLVPLHQEQKKRLNDFVATLEPAAVRA* |
| Ga0137399_109766152 | 3300012203 | Vadose Zone Soil | VSEMGIAGVKFAMDQRGYRGGVPRLPLVPLHQEQKKRLNDFLASLEPAAVRA* |
| Ga0137362_102440811 | 3300012205 | Vadose Zone Soil | RGGIPRLPLLPLHAEQKKRLTEFLLNLEPAAVRA* |
| Ga0137362_108888741 | 3300012205 | Vadose Zone Soil | HAMDQRGYRGGIPRLPLLPLHHEQKKRLTEFLASLEPAAVRA* |
| Ga0137362_115265022 | 3300012205 | Vadose Zone Soil | QRGYRGGAPRSPLLPLSDAAKRRVLDLLATFEPVAARA* |
| Ga0137380_112714752 | 3300012206 | Vadose Zone Soil | MDQRGYRGGLPRLPLLPLHDEQKKRLNTLLETLEPAAMRA* |
| Ga0137384_111308042 | 3300012357 | Vadose Zone Soil | YRGEQPRLPLPPRNDEQKKRLVTLLETLEPAAMLA* |
| Ga0137360_103457671 | 3300012361 | Vadose Zone Soil | KHAMDQRGYRGGIPRLPLLPLHHEQKKRLTEFLASLEPAAVRA* |
| Ga0137360_113843411 | 3300012361 | Vadose Zone Soil | YAMDQRGYRGGIPRPPLLPLQHEQKKRLTEFLATLEPATARA* |
| Ga0137361_105188531 | 3300012362 | Vadose Zone Soil | HAMDQRGYSGGLPRLPLLPLHQEQKKRLNALLATLEPAAVRA* |
| Ga0137390_116859082 | 3300012363 | Vadose Zone Soil | LKYVMDQRGYRGGIPRLPLQPLQNEQKKRLSEFLAILEPIAVRA* |
| Ga0137358_100346741 | 3300012582 | Vadose Zone Soil | VKFVMDQRGYYGGLPRLPLLPLSDGAKKRVLELLAALEPAAARA* |
| Ga0137358_110922462 | 3300012582 | Vadose Zone Soil | RGYRGGLPRLPLLPLHDEQKKRLSELLATLEPAAVRA* |
| Ga0137397_106431842 | 3300012685 | Vadose Zone Soil | GIPVVKFVMDQRGYRGGAPRSPLLPLSDAGKRRVLDLLAAFEPAAARA* |
| Ga0137396_105084352 | 3300012918 | Vadose Zone Soil | GVKFAMDQRGYRGGVPRLPLVPLHQEQKKRLNDFVATLEPAAVRA* |
| Ga0137419_105346262 | 3300012925 | Vadose Zone Soil | GIAGVKFAMDQRGYRGGVPRLPLVPLHQEQKKRLNDFLASLEPAAVRA* |
| Ga0137419_108143962 | 3300012925 | Vadose Zone Soil | YRGGAPRSPLLPLSDAAKRRVLELLAAFEPAAARA* |
| Ga0137416_107412412 | 3300012927 | Vadose Zone Soil | VSEMGIAGVKFAMDQRGYRGGVPRLPLVPLHQEQKKRLNDFLATLEPAAVRA* |
| Ga0137416_110802731 | 3300012927 | Vadose Zone Soil | LIVSEAGIAGVKFVMDQRGYRGGIPRPPLPSLTEEVKKRLIALLAALEPAVARA* |
| Ga0137404_113768482 | 3300012929 | Vadose Zone Soil | DLRGYRGGLPRLPLLPLQPEQKTRLSEFFATLEPAVARA* |
| Ga0137407_106456231 | 3300012930 | Vadose Zone Soil | VMDLRGYRGGLPRLPLLPLQLEQKTRLSEFIATLEPAVARA* |
| Ga0164303_106562131 | 3300012957 | Soil | MDQRGYRGGIPRLPIPPPTEAAKQRILEVLATLEPAAARV* |
| Ga0137411_13705281 | 3300015052 | Vadose Zone Soil | MDQRGYRGGIPRLPLQPLNDERKRRVSDLLGELEPATARA* |
| Ga0167668_11056841 | 3300015193 | Glacier Forefield Soil | PGVKFVMDQRGYRGGVTRSPLLPLSDAAKVRVLEFLATFEPVAARA* |
| Ga0137418_103398693 | 3300015241 | Vadose Zone Soil | RGGAPRSPLLPLSDAAKRRVLDLLANFEPVAARA* |
| Ga0137409_101706291 | 3300015245 | Vadose Zone Soil | GYRGGLPRLPLQPLNEEQRKRISEMLASLEPATARA* |
| Ga0187780_104469712 | 3300017973 | Tropical Peatland | VKYAMDQRGYRGGIPRLPLQPLHEEQKKRICQVLESLEPAVARA |
| Ga0210407_106895761 | 3300020579 | Soil | QRGYRGGIPRLPLQPLSDAAKGRVLELLATSEPAAARA |
| Ga0210406_110558222 | 3300021168 | Soil | VKFVMDQRGYRGGIPRLPLQPLSDAAKGRVLELLATSEPAAARA |
| Ga0210384_115553181 | 3300021432 | Soil | LQAVLARASKLIVSELSIAGVKCAMDQRGYRGGIPRLPLQPLHHEQKKRVTDVLAALEPAAVRA |
| Ga0210409_104249962 | 3300021559 | Soil | LKHVMDQRGYRGGLPRLPLLPLHQEQKKRLNEFLVTLEPAAVRA |
| Ga0179589_103221062 | 3300024288 | Vadose Zone Soil | DFGIAGVKHVMDLRGYKGGHPRLPLLPLEDWHKKRIDGVVAGVEPAAVGACAQ |
| Ga0137417_12604582 | 3300024330 | Vadose Zone Soil | GVKFVMDQRGYRGGLPRLPLVPLSDAAKKRVLEFLATLEPAAARA |
| Ga0207707_108422291 | 3300025912 | Corn Rhizosphere | SVMDQRGYYGGLPRLPLLPVADAAKKRVLELLSTLEPAAARA |
| Ga0207665_107327701 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KYVMDLRGYRGGLPRLPLLPLQPEQKTRLSEFVATLEPAVARA |
| Ga0207711_100950233 | 3300025941 | Switchgrass Rhizosphere | AMDQRGYRGGIPRLPIPPPAESAKQRILEMLATLEPVAARA |
| Ga0209863_101808052 | 3300026281 | Prmafrost Soil | VSEMGIAGVKYAMEQRGYRGGIPRLPLPALSAEQKTKLAAFLATLEQPIMASA |
| Ga0209468_11973841 | 3300026306 | Soil | KYAMDQRGYRGGNPRLPLLPLHSEQKKRLTELLQTLEPAAVRA |
| Ga0209152_104563412 | 3300026325 | Soil | YAMDQRGYRGGNPRLPLLPLHSEQKKRLTELLQTLEPAAVRA |
| Ga0257172_11049461 | 3300026482 | Soil | AGVKFVMDQRGYRGGIPRLPLQPLSDERKARISSLLADLEPATARA |
| Ga0257168_10551641 | 3300026514 | Soil | VSEMGIAGVKFAMDQRGYRGGVPRLPLVPLHQEQKKRLNDFLATLEPAAVRA |
| Ga0179587_107600751 | 3300026557 | Vadose Zone Soil | QRGYHGGLPRLPLLPLADGAKRRVLELLATFEPAAARA |
| Ga0209736_11129341 | 3300027660 | Forest Soil | IVSEMGIAGIKYVMDQRGYRGGIPRLPLQPLSTDQKSRLTTFLATLEQPAMAAT |
| Ga0209248_100164022 | 3300027729 | Bog Forest Soil | VKFVMDQRGYHGGVPRLPLAPLHDEQKKRLSEFLGSLELVAARA |
| Ga0209073_100463172 | 3300027765 | Agricultural Soil | MDQRGYRGGVPRLPLLPLQEEQKKRITALLETFEPAAMRA |
| Ga0209580_101435113 | 3300027842 | Surface Soil | FRGGLPRLPLLPLKDEQKKRVNALLETLEPAAMRA |
| Ga0209701_100815992 | 3300027862 | Vadose Zone Soil | DQRGYRGGAPRSPLLPLSDAAKRRVLDLLATFEPVAARA |
| Ga0209701_103080232 | 3300027862 | Vadose Zone Soil | IPGVKFVMEQRGYHGGAPRLPLQPLSEAAKKRVLEFLATFEPAAATA |
| Ga0209590_101488011 | 3300027882 | Vadose Zone Soil | ELGIPGVKFVMDQRGYHGGAPRLPLQPLSEAAKKRVLEFLATFEPAAATA |
| Ga0209068_109710101 | 3300027894 | Watersheds | DLREYRGGDPRLPLLPLQEEQKKQLSGLLASLEPATARA |
| Ga0308309_104941641 | 3300028906 | Soil | GLTGVKYVMDQRGYRGGIPRLPLLPLHDEQKKRVNELLAGLEPAAMRA |
| Ga0302182_104809691 | 3300030054 | Palsa | SEMGIAGVKFVMDQRGYRGGLPRLPLLPLEEWHKKRITGLLATIEPAAVGACAT |
| Ga0302176_103466622 | 3300030057 | Palsa | KFVMDQRGYRGGLPRLPLLPLEEWHKKRITGLLATIEPAAVGACAT |
| Ga0311356_116843872 | 3300030617 | Palsa | IAGVKFVMDQRGYRGGLPRLPLLPLEEWHKKRITGLLATIEPAAVGACAT |
| Ga0307475_104093341 | 3300031754 | Hardwood Forest Soil | AGVKHTMDQRGYRGGIPRLPLPPLHHEQKKRLTEFLATLEPAAVRA |
| Ga0307475_104836472 | 3300031754 | Hardwood Forest Soil | RGYSGGLPRLPLQPLADSAKRRVLELLATFEPSVARA |
| Ga0307478_110645481 | 3300031823 | Hardwood Forest Soil | IAGVKFVMDQRGYRGGAPRSPLLPLSDAAKRRVLELLATFEPAAARA |
| Ga0310909_104986451 | 3300031947 | Soil | DQRGYRGGLPRLPLLPLQDEQKKRLNAFLEALEPAAMRA |
| Ga0307479_101731233 | 3300031962 | Hardwood Forest Soil | QRGYRGGLPRLPLLPLHDEQKKRLSEFLATMEPAAVRA |
| Ga0307479_108188162 | 3300031962 | Hardwood Forest Soil | MGIAGVKHVMDQRGYRGGIPRLPLLPLHHEQKKRLMEFLANLEPAAVRA |
| Ga0307472_1003176291 | 3300032205 | Hardwood Forest Soil | ASKAIISESGIAGLKHIMDLRGYRGGIPRLPLQPLQPEQKTRLSEFMATLEPAVARA |
| ⦗Top⦘ |