


| Basic Information | |
|---|---|
| Family ID | F092375 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.31 % |
| % of genes near scaffold ends (potentially truncated) | 19.63 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.411 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.813 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.093 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.97% β-sheet: 0.00% Coil/Unstructured: 77.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01176 | eIF-1a | 49.53 |
| PF00313 | CSD | 18.69 |
| PF04820 | Trp_halogenase | 6.54 |
| PF04226 | Transgly_assoc | 1.87 |
| PF01434 | Peptidase_M41 | 0.93 |
| PF01839 | FG-GAP | 0.93 |
| PF02604 | PhdYeFM_antitox | 0.93 |
| PF10431 | ClpB_D2-small | 0.93 |
| PF09694 | Gcw_chp | 0.93 |
| PF14559 | TPR_19 | 0.93 |
| PF03129 | HGTP_anticodon | 0.93 |
| PF01257 | 2Fe-2S_thioredx | 0.93 |
| PF12915 | DUF3833 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 49.53 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.87 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.93 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.93 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.13 % |
| Unclassified | root | N/A | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002IF4YE | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 2199352024|deeps__Contig_162722 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300001989|JGI24739J22299_10175109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 632 | Open in IMG/M |
| 3300002568|C688J35102_120960134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3192 | Open in IMG/M |
| 3300005329|Ga0070683_100332360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1447 | Open in IMG/M |
| 3300005331|Ga0070670_100339793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1318 | Open in IMG/M |
| 3300005334|Ga0068869_100564678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300005338|Ga0068868_101588733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 614 | Open in IMG/M |
| 3300005339|Ga0070660_101419311 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005343|Ga0070687_100979137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 612 | Open in IMG/M |
| 3300005355|Ga0070671_100334753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1291 | Open in IMG/M |
| 3300005356|Ga0070674_102047703 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005364|Ga0070673_101719763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 594 | Open in IMG/M |
| 3300005457|Ga0070662_101371328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 609 | Open in IMG/M |
| 3300005459|Ga0068867_100948687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300005535|Ga0070684_100334622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1392 | Open in IMG/M |
| 3300005535|Ga0070684_100754115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300005539|Ga0068853_101896634 | Not Available | 578 | Open in IMG/M |
| 3300005544|Ga0070686_100000186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 43742 | Open in IMG/M |
| 3300005544|Ga0070686_101834868 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005548|Ga0070665_100000334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 72297 | Open in IMG/M |
| 3300005564|Ga0070664_101140726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 735 | Open in IMG/M |
| 3300005578|Ga0068854_100365581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
| 3300005587|Ga0066654_10240590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| 3300005842|Ga0068858_101082614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300006177|Ga0075362_10698433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 529 | Open in IMG/M |
| 3300006237|Ga0097621_101809729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 582 | Open in IMG/M |
| 3300006854|Ga0075425_102888544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 527 | Open in IMG/M |
| 3300006871|Ga0075434_100303290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1617 | Open in IMG/M |
| 3300009093|Ga0105240_11446245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300009098|Ga0105245_11467507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 733 | Open in IMG/M |
| 3300009098|Ga0105245_12108242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 617 | Open in IMG/M |
| 3300009098|Ga0105245_12209871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 604 | Open in IMG/M |
| 3300009174|Ga0105241_11570858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300009545|Ga0105237_11495900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 682 | Open in IMG/M |
| 3300009551|Ga0105238_11508810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 701 | Open in IMG/M |
| 3300009551|Ga0105238_12277038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 577 | Open in IMG/M |
| 3300010397|Ga0134124_12133467 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010397|Ga0134124_13032392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 513 | Open in IMG/M |
| 3300010400|Ga0134122_10335395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1311 | Open in IMG/M |
| 3300010401|Ga0134121_10584484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1042 | Open in IMG/M |
| 3300011241|Ga0137476_106803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 678 | Open in IMG/M |
| 3300011244|Ga0137483_101546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2775 | Open in IMG/M |
| 3300012212|Ga0150985_103916420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 938 | Open in IMG/M |
| 3300012212|Ga0150985_114153579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 717 | Open in IMG/M |
| 3300012212|Ga0150985_115455613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 562 | Open in IMG/M |
| 3300012212|Ga0150985_116804042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 747 | Open in IMG/M |
| 3300012212|Ga0150985_122739256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 740 | Open in IMG/M |
| 3300012469|Ga0150984_100078174 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012469|Ga0150984_102783843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 771 | Open in IMG/M |
| 3300012469|Ga0150984_103948801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 574 | Open in IMG/M |
| 3300012469|Ga0150984_111355977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 656 | Open in IMG/M |
| 3300012469|Ga0150984_114703103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 765 | Open in IMG/M |
| 3300012469|Ga0150984_118477999 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012469|Ga0150984_120924541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1247 | Open in IMG/M |
| 3300012924|Ga0137413_10413376 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012944|Ga0137410_11991269 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012955|Ga0164298_11242887 | Not Available | 567 | Open in IMG/M |
| 3300013100|Ga0157373_10667960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 760 | Open in IMG/M |
| 3300013296|Ga0157374_11238971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 768 | Open in IMG/M |
| 3300013297|Ga0157378_11792874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 662 | Open in IMG/M |
| 3300013308|Ga0157375_12602702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 604 | Open in IMG/M |
| 3300015064|Ga0167641_106626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1474 | Open in IMG/M |
| 3300015085|Ga0167632_1012275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1203 | Open in IMG/M |
| 3300015161|Ga0167623_1015423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2097 | Open in IMG/M |
| 3300015171|Ga0167648_1104068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium | 564 | Open in IMG/M |
| 3300017792|Ga0163161_10680013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 855 | Open in IMG/M |
| 3300018422|Ga0190265_10769791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1085 | Open in IMG/M |
| 3300018431|Ga0066655_10566041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 761 | Open in IMG/M |
| 3300018432|Ga0190275_10000592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 30469 | Open in IMG/M |
| 3300018469|Ga0190270_12237678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 607 | Open in IMG/M |
| 3300018476|Ga0190274_10327544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1442 | Open in IMG/M |
| 3300019263|Ga0184647_1278407 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300019269|Ga0184644_1709543 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300019279|Ga0184642_1591376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 850 | Open in IMG/M |
| 3300020034|Ga0193753_10243443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 802 | Open in IMG/M |
| 3300020059|Ga0193745_1000002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 637768 | Open in IMG/M |
| 3300020070|Ga0206356_10809954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1352 | Open in IMG/M |
| 3300021384|Ga0213876_10025229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3137 | Open in IMG/M |
| 3300021953|Ga0213880_10002595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3028 | Open in IMG/M |
| 3300025911|Ga0207654_11179400 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300025920|Ga0207649_10544819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 887 | Open in IMG/M |
| 3300025924|Ga0207694_10062831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2892 | Open in IMG/M |
| 3300025927|Ga0207687_10900304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 757 | Open in IMG/M |
| 3300025931|Ga0207644_10556580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 950 | Open in IMG/M |
| 3300025931|Ga0207644_10907231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 739 | Open in IMG/M |
| 3300025935|Ga0207709_11262555 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025944|Ga0207661_10780010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 880 | Open in IMG/M |
| 3300025945|Ga0207679_12146904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 507 | Open in IMG/M |
| 3300025949|Ga0207667_12051407 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025981|Ga0207640_10857410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 791 | Open in IMG/M |
| 3300025981|Ga0207640_11906077 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025986|Ga0207658_11450462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 628 | Open in IMG/M |
| 3300026023|Ga0207677_11901011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 553 | Open in IMG/M |
| 3300026035|Ga0207703_12285926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 516 | Open in IMG/M |
| 3300026088|Ga0207641_10023444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5085 | Open in IMG/M |
| 3300026089|Ga0207648_10970256 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300028379|Ga0268266_10000103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 179736 | Open in IMG/M |
| 3300028790|Ga0307283_10137616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 666 | Open in IMG/M |
| 3300030988|Ga0308183_1032134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 968 | Open in IMG/M |
| 3300031824|Ga0307413_10078746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2104 | Open in IMG/M |
| 3300031824|Ga0307413_10456345 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031824|Ga0307413_10675684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300032004|Ga0307414_10254424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1462 | Open in IMG/M |
| 3300032004|Ga0307414_10629259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 965 | Open in IMG/M |
| 3300032004|Ga0307414_11225518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 695 | Open in IMG/M |
| 3300032126|Ga0307415_101181741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1 | 720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 6.54% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 5.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011241 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 11 - S13.2.50.a - transect 2, age 50 years, surface depth). | Environmental | Open in IMG/M |
| 3300011244 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015064 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_06888940 | 2170459003 | Grass Soil | MKLHNIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG |
| deeps_02998360 | 2199352024 | Soil | MNLQTIGSTRPKLYPPKALLSMGPMERRSPTLSAFELRLIVTEVIG |
| JGI24739J22299_101751092 | 3300001989 | Corn Rhizosphere | MKLSNPGSKRPKLFPPKALLADGPSERRSPTLSGFELRNVVTEMLG* |
| C688J35102_1209601344 | 3300002568 | Soil | MNIQILGSKRPKLWPPKALLSGAPIEARFPTLSGTELRRIVTEVLG* |
| Ga0070683_1003323602 | 3300005329 | Corn Rhizosphere | MNVQNIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG* |
| Ga0070670_1003397935 | 3300005331 | Switchgrass Rhizosphere | MNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEM |
| Ga0068869_1005646783 | 3300005334 | Miscanthus Rhizosphere | MNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG* |
| Ga0068868_1015887332 | 3300005338 | Miscanthus Rhizosphere | MNVQNIGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG* |
| Ga0070660_1014193112 | 3300005339 | Corn Rhizosphere | MNVHTIGSKRPKLYPPKALLAGGPGERRSPTLSGFELRNIVTEMLG* |
| Ga0070687_1009791372 | 3300005343 | Switchgrass Rhizosphere | MNLQTMGPKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0070671_1003347533 | 3300005355 | Switchgrass Rhizosphere | MNVHMTGSKRPKLYPPKALLAAGPIGRRSPTLSGFELRNIVTEMLG* |
| Ga0070674_1020477032 | 3300005356 | Miscanthus Rhizosphere | MNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG* |
| Ga0070673_1017197632 | 3300005364 | Switchgrass Rhizosphere | MNVQMNGSKRPKLYPPKALLAAGPMPDRSPTLSGFELRKIVTEMLG* |
| Ga0070662_1013713282 | 3300005457 | Corn Rhizosphere | MNIEMNGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0068867_1009486873 | 3300005459 | Miscanthus Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLELRHIVTEMLG |
| Ga0070684_1003346225 | 3300005535 | Corn Rhizosphere | MNVEHQGPKRPRLYLPKALLAAGPSQRRSPTLSVLELRAAVTEMVG* |
| Ga0070684_1007541152 | 3300005535 | Corn Rhizosphere | MNTGNPGPKRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG* |
| Ga0068853_1018966341 | 3300005539 | Corn Rhizosphere | MKLSNPGSKRPKLYPPKALLAAGPSERRSPTLSGFELRNVVTEMLG* |
| Ga0070686_10000018615 | 3300005544 | Switchgrass Rhizosphere | MNVQNIGSKRPKLYPPKALLAAGPMPDRSPTLSGFELRKIVTEMLG* |
| Ga0070686_1018348681 | 3300005544 | Switchgrass Rhizosphere | MNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0070665_10000033471 | 3300005548 | Switchgrass Rhizosphere | MNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0070664_1011407262 | 3300005564 | Corn Rhizosphere | MNVHTIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG* |
| Ga0068854_1003655813 | 3300005578 | Corn Rhizosphere | MNIQTNGSMRPKLYPPKALLAAGTTERRPPILSGFELRKIVTEMLG* |
| Ga0066654_102405903 | 3300005587 | Soil | MNGSKRPKLYPPKALLAAGTIERRPPILSGFELRKIVTETLG* |
| Ga0068858_1010826143 | 3300005842 | Switchgrass Rhizosphere | MNVHMTGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG* |
| Ga0075362_106984332 | 3300006177 | Populus Endosphere | MNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG* |
| Ga0097621_1018097292 | 3300006237 | Miscanthus Rhizosphere | MNLQNEGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG* |
| Ga0075425_1028885442 | 3300006854 | Populus Rhizosphere | MKLPNIGPQRPKLYPPKALLAAGPIERRSPTLSGFELRLIVTEMLG* |
| Ga0075434_1003032903 | 3300006871 | Populus Rhizosphere | MKLANIGPQRPKLYPPKALLAAGPIERRSPTLSGFELRLIVTEMLG* |
| Ga0105240_114462452 | 3300009093 | Corn Rhizosphere | MNTGNPGPQRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG* |
| Ga0105245_114675072 | 3300009098 | Miscanthus Rhizosphere | MNVHTDGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG* |
| Ga0105245_121082423 | 3300009098 | Miscanthus Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGL |
| Ga0105245_122098711 | 3300009098 | Miscanthus Rhizosphere | KRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG* |
| Ga0105241_115708582 | 3300009174 | Corn Rhizosphere | MNVHTIGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG* |
| Ga0105237_114959001 | 3300009545 | Corn Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLELRHIVTEML |
| Ga0105238_115088103 | 3300009551 | Corn Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGFELRHIVTEMLG* |
| Ga0105238_122770381 | 3300009551 | Corn Rhizosphere | MNVNYVGSKRPKLYPPKALLAVGPSQRRSPTLSSLELRNIVTEMLG* |
| Ga0134124_121334671 | 3300010397 | Terrestrial Soil | MNINMTGPQRPKLYPPKALLAAGPERRSPTLSGLELRKIVTELLG* |
| Ga0134124_130323921 | 3300010397 | Terrestrial Soil | RNEMNVQMNGSKRPKLYPPKALLAAGPGERRSPTLSGPELRHIVTEMLG* |
| Ga0134122_103353953 | 3300010400 | Terrestrial Soil | MPGSKRPKLYPPKALLGAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0134121_105844843 | 3300010401 | Terrestrial Soil | MTGSKRPKLYPPKALLAAGPIGRRSPTLSGFELRNIVTE |
| Ga0137476_1068032 | 3300011241 | Glacier Forefield Soil | MNLQNIGSTRPKLYPPKALLSMGPMERRSPNLSDAELRYIVIQVIG* |
| Ga0137483_1015462 | 3300011244 | Glacier Forefield Soil | MNLQISGSTRPKLYPPKALLSIGPGERRSPILSGTELRRVVTEVIG* |
| Ga0150985_1039164202 | 3300012212 | Avena Fatua Rhizosphere | MNISTIGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG* |
| Ga0150985_1141535793 | 3300012212 | Avena Fatua Rhizosphere | MNVQMTGSKRPKLSPPKALLAAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0150985_1154556132 | 3300012212 | Avena Fatua Rhizosphere | MNISTIGSKRPKLYPPKALLAAGPGERRSPTLSSFELRMIVTELLG* |
| Ga0150985_1168040421 | 3300012212 | Avena Fatua Rhizosphere | MNVQTTGSKRPKLYPPKALLAAGPIERRSPTLSGLEL |
| Ga0150985_1227392562 | 3300012212 | Avena Fatua Rhizosphere | MIGSKRPKLYPPKALLAAGAIERRSPTLSGIELRHIVTEMLG* |
| Ga0150984_1000781741 | 3300012469 | Avena Fatua Rhizosphere | MNVHNIGSKRPKLYPPKALLAAGPSERRSPTLSGFELRNIVTEMLG* |
| Ga0150984_1027838431 | 3300012469 | Avena Fatua Rhizosphere | MNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHI |
| Ga0150984_1039488012 | 3300012469 | Avena Fatua Rhizosphere | MKLPNIGSTRPKLYPPKALLAAGPGERRSPTLSGFELRNIVTEMLG* |
| Ga0150984_1113559773 | 3300012469 | Avena Fatua Rhizosphere | MNISTIGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG |
| Ga0150984_1147031031 | 3300012469 | Avena Fatua Rhizosphere | MNVQTTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTE |
| Ga0150984_1184779992 | 3300012469 | Avena Fatua Rhizosphere | MTGSKRPKLSPPKALLAAGPIERRSPTLSGLELRHIVTEMLG* |
| Ga0150984_1209245413 | 3300012469 | Avena Fatua Rhizosphere | MIGSKRPKLYPPKALLAAGGIERRSPTLSGIELRHIVTEMLG* |
| Ga0137413_104133763 | 3300012924 | Vadose Zone Soil | MNVHNTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG* |
| Ga0137410_119912692 | 3300012944 | Vadose Zone Soil | MTGSKRPKLSPPKALLAAGPIERRSPTLSGFELRNIVTEMLG* |
| Ga0164298_112428872 | 3300012955 | Soil | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLAGFELRHIVTEMLG* |
| Ga0157373_106679602 | 3300013100 | Corn Rhizosphere | MNIQTNGSMRPKLYPPKALLAAGTIERRPPILSGFELRKIVTEMLG* |
| Ga0157374_112389712 | 3300013296 | Miscanthus Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLELRHIVTEMLG* |
| Ga0157378_117928742 | 3300013297 | Miscanthus Rhizosphere | MNVHTDGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG* |
| Ga0157375_126027022 | 3300013308 | Miscanthus Rhizosphere | MGSTRPKLWPPKALLASGPGDRRSPTLSGTELRRIVTEVLG* |
| Ga0167641_1066263 | 3300015064 | Glacier Forefield Soil | MNTQIMGSTRPKLWPPKALQASGPGDRRSPTLSGTELRRIVTEVLG* |
| Ga0167632_10122753 | 3300015085 | Glacier Forefield Soil | MNTQMTGSTRPKLYPPKALLSIGPIERRSPILSGTELRRIVTEVIG* |
| Ga0167623_10154234 | 3300015161 | Glacier Forefield Soil | MNLQIIGSTRPKLYPPKALLSMGPMERRSPTLSGPELRHIVTQVIG* |
| Ga0167648_11040683 | 3300015171 | Glacier Forefield Soil | MNLQTIGSTRPKLYPPKALLSMGPMERRSPTLSAFELRLIVTEVIG* |
| Ga0163161_106800131 | 3300017792 | Switchgrass Rhizosphere | MNIHTDGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG |
| Ga0190265_107697911 | 3300018422 | Soil | MNLQITGSKRPKLHLPKALLSSGSGDRRSPLLSGTELRRIVTQVIG |
| Ga0066655_105660412 | 3300018431 | Grasslands Soil | MNTNMTGSKRPKLYLPKALLAAGMSERRAPILSRPELRTIVIELLG |
| Ga0190275_100005929 | 3300018432 | Soil | MNLLTIGSTRPKLYPPKALLSMGPTERRSPNLSGTELRRIVTQVIG |
| Ga0190270_122376782 | 3300018469 | Soil | MNVHIAGSKRPKLYPPKALLACGPTERRSPTLSGFELRHIVTEMLG |
| Ga0190274_103275442 | 3300018476 | Soil | MNVHITGSKRPKLYPPKALLACGPIERRSPTLSGFELRHIVTEMLG |
| Ga0184647_12784071 | 3300019263 | Groundwater Sediment | MNIHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG |
| Ga0184644_17095433 | 3300019269 | Groundwater Sediment | MNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG |
| Ga0184642_15913763 | 3300019279 | Groundwater Sediment | MNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG |
| Ga0193753_102434431 | 3300020034 | Soil | MNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG |
| Ga0193745_1000002250 | 3300020059 | Soil | MNTQIMGSTRPKLWPPKALLASGPGDRRSPTLSGTELRRIVTEVLG |
| Ga0206356_108099543 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTGNPGPQRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG |
| Ga0213876_100252295 | 3300021384 | Plant Roots | MNVEHQGPKRPRLYLPKALLAAGPAPCRSPTLSTLELRAAVTEMVG |
| Ga0213880_100025951 | 3300021953 | Exposed Rock | MNIGHPGPKRPKLYPPKALLAAGPSERRSPILSSFELRNIVTELLG |
| Ga0207654_111794003 | 3300025911 | Corn Rhizosphere | MNTGNPGPKRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG |
| Ga0207649_105448191 | 3300025920 | Corn Rhizosphere | MNVQTNGSKRPKLFLPKALLAAGPSDRRSPTLSGFELRNIVTEMLG |
| Ga0207694_100628313 | 3300025924 | Corn Rhizosphere | MNTGNPGPQRPKLYPPKALLAAGPTERRSPILSSFELRNIVTESLG |
| Ga0207687_109003042 | 3300025927 | Miscanthus Rhizosphere | MNVHTDGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG |
| Ga0207644_105565801 | 3300025931 | Switchgrass Rhizosphere | SKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG |
| Ga0207644_109072311 | 3300025931 | Switchgrass Rhizosphere | MNVHMTGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG |
| Ga0207709_112625551 | 3300025935 | Miscanthus Rhizosphere | MNVQNIGSKRPKLYPPKALLAAGPMPDRSPTLSGFELRKIVTEMLG |
| Ga0207661_107800101 | 3300025944 | Corn Rhizosphere | QITRRGVPPRTEMNVQNIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG |
| Ga0207679_121469042 | 3300025945 | Corn Rhizosphere | MNVHTIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG |
| Ga0207667_120514072 | 3300025949 | Corn Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLE |
| Ga0207640_108574102 | 3300025981 | Corn Rhizosphere | MNIQTNGSMRPKLYPPKALLAAGTTERRPPILSGFELRKIVTEMLG |
| Ga0207640_119060771 | 3300025981 | Corn Rhizosphere | MNTQIIGSTRPKLYPPKALLSIWPEQRRSPLLSGTELR |
| Ga0207658_114504622 | 3300025986 | Switchgrass Rhizosphere | MNVHTIGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG |
| Ga0207677_119010112 | 3300026023 | Miscanthus Rhizosphere | MNVQNIGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG |
| Ga0207703_122859262 | 3300026035 | Switchgrass Rhizosphere | MNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGFELRHIVTEMLG |
| Ga0207641_100234445 | 3300026088 | Switchgrass Rhizosphere | MNVHMTGSKRPKLYPPKALLAAGPIGRRSPTLSGFELRNIVTEMLG |
| Ga0207648_109702562 | 3300026089 | Miscanthus Rhizosphere | MNVQNIGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG |
| Ga0268266_1000010344 | 3300028379 | Switchgrass Rhizosphere | MNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG |
| Ga0307283_101376163 | 3300028790 | Soil | PPRIKMNVHSEGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG |
| Ga0308183_10321343 | 3300030988 | Soil | MNVHSEGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG |
| Ga0307413_100787464 | 3300031824 | Rhizosphere | MNIETIGSTRPKLHLPKALLSDGSGERRAPTLSSFELRRIVAELLG |
| Ga0307413_104563451 | 3300031824 | Rhizosphere | MKRRRFPPESEMNIETIGSTRPKLYLPKALLSERSGERRVPTLSSFELKRIVAELLG |
| Ga0307413_106756843 | 3300031824 | Rhizosphere | MMRRIFPPESEMNIETIGSARPKLYLPKALLSERSSESRLATLSSFELRRIVAELLG |
| Ga0307414_102544245 | 3300032004 | Rhizosphere | MKRRRFPPENEMNIETIGSTRPKLFLPKALLSERPSERRVPTLSSFELRRIVAELLG |
| Ga0307414_106292593 | 3300032004 | Rhizosphere | MKRRKIPPESEMNIETIGSTRPKLHLPKALLSDGSGERRAPTLSSFELRRIVAELLG |
| Ga0307414_112255182 | 3300032004 | Rhizosphere | RRRSPPESKMNIETIGSTRPKLYLPKALLSERSGERRVPTLSSFELKRIVAELLG |
| Ga0307415_1011817411 | 3300032126 | Rhizosphere | PPESKMNIETIGSTRPKLYLPKALLSERSGERRVPTLSSFELKRIVAELLG |
| ⦗Top⦘ |