


| Basic Information | |
|---|---|
| Family ID | F092296 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLE |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.54 % |
| % of genes near scaffold ends (potentially truncated) | 90.65 % |
| % of genes from short scaffolds (< 2000 bps) | 97.20 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.953 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.383 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07799 | DUF1643 | 19.63 |
| PF07690 | MFS_1 | 7.48 |
| PF00355 | Rieske | 6.54 |
| PF01734 | Patatin | 4.67 |
| PF00005 | ABC_tran | 4.67 |
| PF03401 | TctC | 3.74 |
| PF12796 | Ank_2 | 2.80 |
| PF13180 | PDZ_2 | 2.80 |
| PF04972 | BON | 2.80 |
| PF03328 | HpcH_HpaI | 2.80 |
| PF01844 | HNH | 2.80 |
| PF04471 | Mrr_cat | 1.87 |
| PF00472 | RF-1 | 1.87 |
| PF14833 | NAD_binding_11 | 1.87 |
| PF00270 | DEAD | 1.87 |
| PF13744 | HTH_37 | 1.87 |
| PF07963 | N_methyl | 1.87 |
| PF04365 | BrnT_toxin | 0.93 |
| PF13470 | PIN_3 | 0.93 |
| PF01144 | CoA_trans | 0.93 |
| PF13561 | adh_short_C2 | 0.93 |
| PF01042 | Ribonuc_L-PSP | 0.93 |
| PF01738 | DLH | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF08309 | LVIVD | 0.93 |
| PF08388 | GIIM | 0.93 |
| PF12848 | ABC_tran_Xtn | 0.93 |
| PF08450 | SGL | 0.93 |
| PF10049 | DUF2283 | 0.93 |
| PF11604 | CusF_Ec | 0.93 |
| PF13649 | Methyltransf_25 | 0.93 |
| PF00462 | Glutaredoxin | 0.93 |
| PF13544 | Obsolete Pfam Family | 0.93 |
| PF01797 | Y1_Tnp | 0.93 |
| PF13365 | Trypsin_2 | 0.93 |
| PF08378 | NERD | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG4333 | Uncharacterized conserved protein, DUF1643 domain | Function unknown [S] | 19.63 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 4.67 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 4.67 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 4.67 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.74 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.80 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 2.80 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 2.80 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.93 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.93 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.93 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.93 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.93 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.93 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.93 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.93 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.26 % |
| Unclassified | root | N/A | 3.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_4977117 | Not Available | 818 | Open in IMG/M |
| 3300001305|C688J14111_10031298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1585 | Open in IMG/M |
| 3300002907|JGI25613J43889_10072058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300005175|Ga0066673_10377797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 827 | Open in IMG/M |
| 3300005175|Ga0066673_10466491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 743 | Open in IMG/M |
| 3300005184|Ga0066671_10087988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1691 | Open in IMG/M |
| 3300005184|Ga0066671_10750682 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005186|Ga0066676_11058906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300005187|Ga0066675_11096036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 595 | Open in IMG/M |
| 3300005340|Ga0070689_100571812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 976 | Open in IMG/M |
| 3300005347|Ga0070668_101522866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300005459|Ga0068867_100871544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 808 | Open in IMG/M |
| 3300005466|Ga0070685_10647715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 765 | Open in IMG/M |
| 3300005530|Ga0070679_101811090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300005545|Ga0070695_100549717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 900 | Open in IMG/M |
| 3300006032|Ga0066696_10524119 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006047|Ga0075024_100844026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 516 | Open in IMG/M |
| 3300006224|Ga0079037_101472280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 679 | Open in IMG/M |
| 3300006604|Ga0074060_12067161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300006605|Ga0074057_11162073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300006800|Ga0066660_10320856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1245 | Open in IMG/M |
| 3300006853|Ga0075420_100781245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300006853|Ga0075420_101097861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 684 | Open in IMG/M |
| 3300007004|Ga0079218_10032243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3052 | Open in IMG/M |
| 3300007258|Ga0099793_10368758 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300007258|Ga0099793_10666162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300009053|Ga0105095_10124397 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300009081|Ga0105098_10579050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300009087|Ga0105107_10075004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2386 | Open in IMG/M |
| 3300009088|Ga0099830_10269077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1353 | Open in IMG/M |
| 3300009089|Ga0099828_11178037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300009090|Ga0099827_11421096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300009147|Ga0114129_11386906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300009171|Ga0105101_10083776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1549 | Open in IMG/M |
| 3300009233|Ga0103856_10052721 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300009610|Ga0105340_1084054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1265 | Open in IMG/M |
| 3300010399|Ga0134127_12629229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 583 | Open in IMG/M |
| 3300010401|Ga0134121_10487960 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300010401|Ga0134121_12531297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300010403|Ga0134123_13430215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300011402|Ga0137356_1103453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300011421|Ga0137462_1052385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300011430|Ga0137423_1167312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300011430|Ga0137423_1244754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300011435|Ga0137426_1235030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300012038|Ga0137431_1227976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300012096|Ga0137389_11083516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 686 | Open in IMG/M |
| 3300012157|Ga0137353_1079886 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012163|Ga0137355_1085537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300012212|Ga0150985_111231250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1756 | Open in IMG/M |
| 3300012685|Ga0137397_11362051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300012925|Ga0137419_11235117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300012925|Ga0137419_11352543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300012927|Ga0137416_11573544 | Not Available | 598 | Open in IMG/M |
| 3300012927|Ga0137416_11654196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 583 | Open in IMG/M |
| 3300012927|Ga0137416_11661376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300012972|Ga0134077_10072212 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300012986|Ga0164304_10515985 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300013297|Ga0157378_10603544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300013297|Ga0157378_12324247 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300013760|Ga0120188_1053140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300014745|Ga0157377_10934592 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300014871|Ga0180095_1047130 | Not Available | 757 | Open in IMG/M |
| 3300015245|Ga0137409_10229868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. | 1656 | Open in IMG/M |
| 3300015245|Ga0137409_10676082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300018083|Ga0184628_10094413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1535 | Open in IMG/M |
| 3300018422|Ga0190265_10855813 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300018429|Ga0190272_12040739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300018429|Ga0190272_12091299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM3983 | 603 | Open in IMG/M |
| 3300018433|Ga0066667_10872940 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300018476|Ga0190274_13764009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300019789|Ga0137408_1155204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1021 | Open in IMG/M |
| 3300022694|Ga0222623_10345788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300024177|Ga0247686_1014918 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300024232|Ga0247664_1036739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1140 | Open in IMG/M |
| 3300025885|Ga0207653_10238151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300025885|Ga0207653_10265540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300025901|Ga0207688_10870678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300025910|Ga0207684_10957529 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300025936|Ga0207670_10558886 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300025941|Ga0207711_10271377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1561 | Open in IMG/M |
| 3300026285|Ga0209438_1228731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300026324|Ga0209470_1273111 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300026327|Ga0209266_1264360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300026331|Ga0209267_1291929 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027713|Ga0209286_1140598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300027840|Ga0209683_10420867 | Not Available | 613 | Open in IMG/M |
| 3300027886|Ga0209486_10664077 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027915|Ga0209069_10907480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300028536|Ga0137415_10498689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1025 | Open in IMG/M |
| 3300028608|Ga0247819_10137963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1262 | Open in IMG/M |
| 3300028802|Ga0307503_10754800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300028812|Ga0247825_11380210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031170|Ga0307498_10323152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
| 3300031547|Ga0310887_10188640 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300031740|Ga0307468_101236508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300032005|Ga0307411_10990778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300032075|Ga0310890_11103403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300032122|Ga0310895_10351954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300032157|Ga0315912_10282965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1306 | Open in IMG/M |
| 3300032180|Ga0307471_101227043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 914 | Open in IMG/M |
| 3300032205|Ga0307472_101618423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 637 | Open in IMG/M |
| 3300032782|Ga0335082_10258739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1621 | Open in IMG/M |
| 3300032828|Ga0335080_10003480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15925 | Open in IMG/M |
| 3300032955|Ga0335076_11008667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300033812|Ga0364926_126934 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300034663|Ga0314784_090965 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0015.00003320 | 2162886013 | Switchgrass Rhizosphere | GYGYSPEGSTPERLTEINRDDLALWRRLVREANIPLE |
| C688J14111_100312981 | 3300001305 | Soil | AALKRPEVLEKLQSYGYAAEGSTAERLFEINRDDLALWKKLVAEAGIALE* |
| JGI25613J43889_100720583 | 3300002907 | Grasslands Soil | VTAVVKRPDVVAKLQSYGYAAESSTPERMWEINRDDLVLWKKLIAEANLALE* |
| Ga0066673_103777972 | 3300005175 | Soil | KLQSYGYAAEGSTPERLLEINRDDLALWRKLVREANIPLE* |
| Ga0066673_104664911 | 3300005175 | Soil | VNAALKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIALE* |
| Ga0066671_100879881 | 3300005184 | Soil | VRRPEVVEKMQSYGYAAEGSTPERLFEINRDDLALWRKLIAEARLELD* |
| Ga0066671_107506821 | 3300005184 | Soil | PEVIERMQSYGYAAEGSTPERLLEINRDDLALWRKLITDAGLELD* |
| Ga0066676_110589061 | 3300005186 | Soil | KRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIPLE* |
| Ga0066675_110960361 | 3300005187 | Soil | VKRPEVIERMQSYGYAAEGSTPERLLEINRDDLALWRKLITDAGLELD* |
| Ga0070689_1005718121 | 3300005340 | Switchgrass Rhizosphere | AALKRPDVIEKLLSYGYSPEGSTPERLTEINRDDLALWRRLVREANIPLE* |
| Ga0070668_1015228662 | 3300005347 | Switchgrass Rhizosphere | AKLQSYGYSPEGSTPERLLELNRADLELWRRLVKEAGIPLE* |
| Ga0068867_1008715441 | 3300005459 | Miscanthus Rhizosphere | DVLEKLQSYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE* |
| Ga0070685_106477152 | 3300005466 | Switchgrass Rhizosphere | PEMVEKLQSYGYAPEGSTPERLFEINRDDLALWKKLVQQAKLPLE* |
| Ga0070679_1018110901 | 3300005530 | Corn Rhizosphere | QRPDVIAKLQSYGYSPEGSTPERLLELNRADLDLWRRLVKEAGIPLE* |
| Ga0070695_1005497173 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EKLLGYGYSPEGSTPERLTEINRDDLALWRRLVREASIPLE* |
| Ga0066696_105241193 | 3300006032 | Soil | SYGYAAEGSTPERLFEINRDDLALWRKLIADARIELD* |
| Ga0075024_1008440261 | 3300006047 | Watersheds | PDVLEKLQSYGYAAEGSTPERLLDINREDLALWRRLVREAGIPLE* |
| Ga0079037_1014722802 | 3300006224 | Freshwater Wetlands | VTALKRPEVLDKLLSYGYVVEGSTPEGLATINRDDLVLWRRLVKEAGIPVE* |
| Ga0074060_120671612 | 3300006604 | Soil | NAALKRPEVLEKLQSYGYAAEGSTPERLFEINRDDLALWRKLVKQAAIPLE* |
| Ga0074057_111620732 | 3300006605 | Soil | LGYGYSPEGSTPERLLEINRDDLALWRKLVKQAAIPLE* |
| Ga0066660_103208562 | 3300006800 | Soil | AKLQSYGYAVEGSTPERLLEINRDDLALWRKLVREANIPLE* |
| Ga0075420_1007812453 | 3300006853 | Populus Rhizosphere | RPDVIAKLQSYGYSPEGSTPERLLEVNRADLELWRRLVKEAGIPLE* |
| Ga0075420_1010978612 | 3300006853 | Populus Rhizosphere | KLLSYGYAAEGSSPERLLEINRDDLALWRKLVGEARIPLE* |
| Ga0079218_100322431 | 3300007004 | Agricultural Soil | KLQSYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE* |
| Ga0099793_103687582 | 3300007258 | Vadose Zone Soil | NAALKRPDVLEQLQRYGYAAEGSTPEGLTAINRADLALWRKLVAEAGIALE* |
| Ga0099793_106661622 | 3300007258 | Vadose Zone Soil | PDVLEQLQRYGYAAEGSTPEGLTAINREDLALWRKLVAEAGIALE* |
| Ga0105095_101243972 | 3300009053 | Freshwater Sediment | MDRLLKAALPRSDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD* |
| Ga0105098_105790502 | 3300009081 | Freshwater Sediment | VLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLE* |
| Ga0105107_100750043 | 3300009087 | Freshwater Sediment | MDRLLKAALPRPDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD* |
| Ga0099830_102690771 | 3300009088 | Vadose Zone Soil | VLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVKEAGIPLE* |
| Ga0099828_111780371 | 3300009089 | Vadose Zone Soil | QRYGYAAEGSTPEGLTAINREDLALWRKLVREAGIPLE* |
| Ga0099827_114210961 | 3300009090 | Vadose Zone Soil | KRPDVLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVREAGIPLE* |
| Ga0114129_113869062 | 3300009147 | Populus Rhizosphere | YATEGSTPERVLEINREDLALWRRLVKEAGIPLE* |
| Ga0105101_100837763 | 3300009171 | Freshwater Sediment | AAILYSDAWKAAMDRLLKAALPRSDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD* |
| Ga0103856_100527213 | 3300009233 | River Water | KNFLSFGYAIEGSTPEELAAINRNDLVLWRRLVKEANVTLD* |
| Ga0105340_10840541 | 3300009610 | Soil | NAALKRPDVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLD* |
| Ga0134127_126292291 | 3300010399 | Terrestrial Soil | RADVREKLLSYGYAAEGSTPERLLEINRDDLALWRKLVKEAGIPLE* |
| Ga0134121_104879601 | 3300010401 | Terrestrial Soil | RPDVIERMQSYGYVAESSTPERLLEINRDDLALWRKLVADAGMALD* |
| Ga0134121_125312971 | 3300010401 | Terrestrial Soil | GYGFAAEGSTPDGLAAINRDDLALWRRLVREANIPLE* |
| Ga0134123_134302151 | 3300010403 | Terrestrial Soil | LLSYGYSPEGSTPERLLEINRDDLALWRRLVKEANIPLE* |
| Ga0137356_11034531 | 3300011402 | Soil | LQGYGYAAEGSTPERLLEINRDDLALWRKLVNEAGIPLE* |
| Ga0137462_10523851 | 3300011421 | Soil | GYSAEGSTPERLLEINRDDLALWRKLVKEAGIPLE* |
| Ga0137423_11673121 | 3300011430 | Soil | YGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLE* |
| Ga0137423_12447541 | 3300011430 | Soil | VNAALKRPEVLEKMQSYGYAAEGSTAERLLEINRDDLALWRKLVNEAGIPLE* |
| Ga0137426_12350301 | 3300011435 | Soil | PEVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVNQAGIPLE* |
| Ga0137431_12279762 | 3300012038 | Soil | EVNILLKRKDVLDKLQSYGYAAEGSTPERLLEINRADLELWRRLVKEAGIPLE* |
| Ga0137389_110835161 | 3300012096 | Vadose Zone Soil | VLEQLQRYGYAAEGSTPEGLTAINREDLALWRKLVKEAGIPLE* |
| Ga0137353_10798862 | 3300012157 | Soil | RRPDVLEKLQGYGYAAEGSTPERLAEINRDDLALWRRLVRAAGIPLE* |
| Ga0137355_10855372 | 3300012163 | Soil | VLKRPEVLEKLQSYGYAAEGSTPERLLEINRADLALWRKLVKEAGIPLE* |
| Ga0150985_1112312503 | 3300012212 | Avena Fatua Rhizosphere | QSYGYAAEGSTPERLFEINRDDLALWKKLVAEAGIALE* |
| Ga0137397_113620512 | 3300012685 | Vadose Zone Soil | RPEVLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVREAGIALE* |
| Ga0137419_112351172 | 3300012925 | Vadose Zone Soil | EQLQRYGYAAEGSTPEGLTAINRADLALWRKLVAEAGIALE* |
| Ga0137419_113525431 | 3300012925 | Vadose Zone Soil | RADVREKLQSYGYAAEGSTPERLLEINRDDLALWRKLVREANIPLE* |
| Ga0137416_115735441 | 3300012927 | Vadose Zone Soil | YAAEGSTPEGLTAINREDLALWRKLVREAGIALE* |
| Ga0137416_116541961 | 3300012927 | Vadose Zone Soil | RMQSYGYTAEGSTPERLLEINRDDLALWRKLVADAGLALD* |
| Ga0137416_116613762 | 3300012927 | Vadose Zone Soil | LQRYGYAAEGSTPEGLTAINREDLALWRKLVREAGIPLE* |
| Ga0134077_100722122 | 3300012972 | Grasslands Soil | LKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIPLE* |
| Ga0164304_105159852 | 3300012986 | Soil | VLEKLQSYGYAAEGSTPERLFEINRDDLALWQKLVKQAAIPLE* |
| Ga0157378_106035441 | 3300013297 | Miscanthus Rhizosphere | KEVNAAVRRPDIAGQLLKYGYQPEGSPPDELLAINRDDLALWRKLVADAKIPLE* |
| Ga0157378_123242471 | 3300013297 | Miscanthus Rhizosphere | TEVNGALKRADVLEKLLSNAYVAEGSTPEGLLAINRDDLALWRKLVKEAGIALD* |
| Ga0120188_10531402 | 3300013760 | Terrestrial | DVLEKLQPYGYAAEGSTPERLAEINRTDLELWRRLVKEAGLPLD* |
| Ga0157377_109345921 | 3300014745 | Miscanthus Rhizosphere | RPEVLEKLQSYGYAAEGSTPERLFEINRDDLALWRKLVAQAGIPLE* |
| Ga0180095_10471302 | 3300014871 | Soil | QTYGYSPEGSTPQGLLEINREDLALWRRLIAEAKLPLE* |
| Ga0137409_102298682 | 3300015245 | Vadose Zone Soil | NAALKRPEVLEQLQRYGYAAEGSTPEGLTAINREDLALWRKLVREAGIALE* |
| Ga0137409_106760823 | 3300015245 | Vadose Zone Soil | KMQSYGYAAEGSTPGELYEINRADLALWRKLIADAGLELD* |
| Ga0184628_100944131 | 3300018083 | Groundwater Sediment | GYSAEGSTPERLLEINRDDLALWRKLVKEAGIPLE |
| Ga0190265_108558131 | 3300018422 | Soil | KLQSYGYAAEGSTPEGLLEINRVDLELWRKLVKEAGIPLE |
| Ga0190272_120407392 | 3300018429 | Soil | VAEKLQSYGYSPEGSTPERLVEVNRADLELWRKLVKEAGIPLE |
| Ga0190272_120912991 | 3300018429 | Soil | NAALKRPDVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAAIPLE |
| Ga0066667_108729402 | 3300018433 | Grasslands Soil | VNAALKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIPLE |
| Ga0190274_137640091 | 3300018476 | Soil | LQGYGYAAEGSTPEGLLAINRDDLALWRRLVREANIPLE |
| Ga0137408_11552045 | 3300019789 | Vadose Zone Soil | PLDFGFVKKGPTPEGLLAINRDDLALWRRLVNEAGIPLE |
| Ga0222623_103457881 | 3300022694 | Groundwater Sediment | ALRRPEVLEKLQSYGYSAEGSTPERLLEINRDDLALWRKLVGEAGIPLE |
| Ga0247686_10149181 | 3300024177 | Soil | ALKRPDVAEKLLGYGYSPEGSTPERLLEINRDDLALWRKLVKEANIPLE |
| Ga0247664_10367393 | 3300024232 | Soil | GYAPEGSTPERLFEINRDDLALWKKLVQQAKLPLE |
| Ga0207653_102381512 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPDGKRDVIAKLQSYGYSPEGSTPERLLELNRADLDLWRRLVKEAGIPLE |
| Ga0207653_102655401 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | QVVEKMQSYGYAAESSTAAELYEINRADLELWRKLIADARLELD |
| Ga0207688_108706781 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | EKLQSYGYAPEGSTPERLFEINRDDLALWKKLVQQAKLPLE |
| Ga0207684_109575292 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KPRSYGYATEGSTPERLLEINRDDLALWRRLVKDAGIPLE |
| Ga0207670_105588861 | 3300025936 | Switchgrass Rhizosphere | IEKLRSYGYATEGSTPERLLEINRNDLALWRRLVKDAGIPLE |
| Ga0207711_102713771 | 3300025941 | Switchgrass Rhizosphere | KLQSYGYAAEGSTPERLFEINRDDLALWRKLVAQAGIPLE |
| Ga0209438_12287311 | 3300026285 | Grasslands Soil | DVVAKLQSYGYAAESSTPERMWEINRDDLVLWKKLIAEANLALE |
| Ga0209470_12731112 | 3300026324 | Soil | VLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVREAGIPLE |
| Ga0209266_12643602 | 3300026327 | Soil | VLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREASIALE |
| Ga0209267_12919291 | 3300026331 | Soil | SYGYAAEGSTPEGLAAINRDDLALWRRLVREAGIPLE |
| Ga0209286_11405982 | 3300027713 | Freshwater Sediment | MDRLLKAALPRSDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD |
| Ga0209683_104208672 | 3300027840 | Wetland Sediment | FLGFGYAIEGSTPEELAAINRNDLVLWRKLVKEANVPLE |
| Ga0209486_106640771 | 3300027886 | Agricultural Soil | LQSYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE |
| Ga0209069_109074801 | 3300027915 | Watersheds | PDVLEKLQSYGYAAEGSTPERLLDINREDLALWRRLVREAGIPLE |
| Ga0137415_104986894 | 3300028536 | Vadose Zone Soil | QRYGYAAEGSTPEGLTAINRADLALWRKLVAEAGIALE |
| Ga0247819_101379631 | 3300028608 | Soil | DVIAKLQSYGYSPEGSTPERLLELNRADLDLWRRLVKEAGIPLE |
| Ga0307503_107548001 | 3300028802 | Soil | RPDVAEQMLKYGYQPEGSTPEGLLEINRADLALWRKLVADAKLPLE |
| Ga0247825_113802102 | 3300028812 | Soil | QLLRYGYSPEASTPERLLEINREDLALWRKLIVEAKLPLE |
| Ga0307498_103231522 | 3300031170 | Soil | YGYAAEGSTPERLLEINRDDLALWRKLVKEAGIPLE |
| Ga0310887_101886401 | 3300031547 | Soil | YGYAAEGTTPERLFEINRDDLALWKKLVAQARIPLE |
| Ga0307468_1012365082 | 3300031740 | Hardwood Forest Soil | AKLQSYGYAAESSTPERMWEINRDDLVLWRKLIADANLALE |
| Ga0307411_109907783 | 3300032005 | Rhizosphere | VIEKLQSYGYSPEGSTPERLLEVNRADLELWRKLVKEAGIPLE |
| Ga0310890_111034031 | 3300032075 | Soil | LLKKPDVIEKLQSYGYSPEGSTPERLLEVNRADLELWRRLVKEAGIPLE |
| Ga0310895_103519541 | 3300032122 | Soil | DVIEKLQSYGYSPEGSTPERLLEVNRADLELWRRLVKEAGIPLE |
| Ga0315912_102829653 | 3300032157 | Soil | QSSGYSPEGSTPERLSEINRDDLVLWRRLVKEAGIPLE |
| Ga0307471_1012270433 | 3300032180 | Hardwood Forest Soil | KMQSYGYAAEASSPERLLEINRDDLALWRKLIAEAGIALD |
| Ga0307472_1016184232 | 3300032205 | Hardwood Forest Soil | EVNAALKRPDVVEKLQSYGYAAEGSTSERLLEINREDLALWRRLVREAGIPLE |
| Ga0335082_102587392 | 3300032782 | Soil | VSSSRSAAYAAEGSTPEALRAVNREDPALWRKLVKDSGIPLE |
| Ga0335080_100034807 | 3300032828 | Soil | VSSSRSAAYAAEGSTPEALRAGNREDPALWRKLVKDSGIPLE |
| Ga0335076_110086672 | 3300032955 | Soil | VSSSRPAAYAAEGSTPEALRAVNREDPALWRKLVKDSGIPLE |
| Ga0364926_126934_413_538 | 3300033812 | Sediment | EKLQGYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE |
| Ga0314784_090965_3_134 | 3300034663 | Soil | VIEKLQTYGYAAEGSTPERLAEINRDDLALWKKLVAEARIPLE |
| ⦗Top⦘ |