


| Basic Information | |
|---|---|
| Family ID | F092217 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYEDA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.02 % |
| % of genes near scaffold ends (potentially truncated) | 27.10 % |
| % of genes from short scaffolds (< 2000 bps) | 93.46 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.140 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (37.383 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.178 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.981 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 65.42 |
| PF06714 | Gp5_OB | 2.80 |
| PF10544 | T5orf172 | 1.87 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.87 |
| PF04545 | Sigma70_r4 | 0.93 |
| PF11953 | DUF3470 | 0.93 |
| PF13237 | Fer4_10 | 0.93 |
| PF06945 | DUF1289 | 0.93 |
| PF00156 | Pribosyltran | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.14 % |
| All Organisms | root | All Organisms | 44.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000140|LPfeb09P26500mDRAFT_c1009124 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300000152|LPjun08P12500mDRAFT_c1014993 | Not Available | 1316 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1013319 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300000260|LP_A_09_P20_500DRAFT_1011516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1411 | Open in IMG/M |
| 3300001450|JGI24006J15134_10124569 | Not Available | 883 | Open in IMG/M |
| 3300001589|JGI24005J15628_10111411 | Not Available | 898 | Open in IMG/M |
| 3300001683|GBIDBA_10026511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2946 | Open in IMG/M |
| 3300001683|GBIDBA_10047066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Robiginitomaculaceae → Robiginitomaculum → unclassified Robiginitomaculum → Robiginitomaculum sp. | 1651 | Open in IMG/M |
| 3300005402|Ga0066855_10283442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 545 | Open in IMG/M |
| 3300005426|Ga0066847_10029108 | Not Available | 1785 | Open in IMG/M |
| 3300005427|Ga0066851_10037383 | Not Available | 1698 | Open in IMG/M |
| 3300005520|Ga0066864_10044831 | Not Available | 1331 | Open in IMG/M |
| 3300005945|Ga0066381_10113280 | Not Available | 770 | Open in IMG/M |
| 3300005969|Ga0066369_10046088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1556 | Open in IMG/M |
| 3300006306|Ga0068469_1114291 | Not Available | 540 | Open in IMG/M |
| 3300006310|Ga0068471_1250170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
| 3300006310|Ga0068471_1519979 | Not Available | 1348 | Open in IMG/M |
| 3300006310|Ga0068471_1579693 | Not Available | 2000 | Open in IMG/M |
| 3300006324|Ga0068476_1476154 | Not Available | 972 | Open in IMG/M |
| 3300006335|Ga0068480_1205900 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300006339|Ga0068481_1576756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300006339|Ga0068481_1576963 | Not Available | 1981 | Open in IMG/M |
| 3300006340|Ga0068503_10340346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300006340|Ga0068503_10629995 | Not Available | 788 | Open in IMG/M |
| 3300006341|Ga0068493_10249240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
| 3300006341|Ga0068493_10613223 | Not Available | 1648 | Open in IMG/M |
| 3300006346|Ga0099696_1134458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300006416|Ga0100043_10144345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300006752|Ga0098048_1217309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 562 | Open in IMG/M |
| 3300006753|Ga0098039_1212212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 655 | Open in IMG/M |
| 3300006753|Ga0098039_1271868 | Not Available | 568 | Open in IMG/M |
| 3300006789|Ga0098054_1035548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1939 | Open in IMG/M |
| 3300006900|Ga0066376_10413427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 770 | Open in IMG/M |
| 3300006921|Ga0098060_1121640 | Not Available | 732 | Open in IMG/M |
| 3300006926|Ga0098057_1089644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 749 | Open in IMG/M |
| 3300007291|Ga0066367_1129440 | Not Available | 943 | Open in IMG/M |
| 3300007291|Ga0066367_1163775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 843 | Open in IMG/M |
| 3300007508|Ga0105011_1086495 | Not Available | 1260 | Open in IMG/M |
| 3300007647|Ga0102855_1025776 | All Organisms → Viruses → Predicted Viral | 1618 | Open in IMG/M |
| 3300007692|Ga0102823_1218324 | Not Available | 511 | Open in IMG/M |
| 3300008050|Ga0098052_1239327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 696 | Open in IMG/M |
| 3300008629|Ga0115658_1076381 | Not Available | 1946 | Open in IMG/M |
| 3300009008|Ga0115649_1131576 | Not Available | 2224 | Open in IMG/M |
| 3300009104|Ga0117902_1264134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1629 | Open in IMG/M |
| 3300009104|Ga0117902_1323555 | Not Available | 1413 | Open in IMG/M |
| 3300009173|Ga0114996_10427029 | Not Available | 1011 | Open in IMG/M |
| 3300009173|Ga0114996_10821693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 671 | Open in IMG/M |
| 3300009409|Ga0114993_10330059 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300009593|Ga0115011_10115849 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
| 3300009619|Ga0105236_1047737 | Not Available | 564 | Open in IMG/M |
| 3300009786|Ga0114999_11097354 | Not Available | 571 | Open in IMG/M |
| 3300009790|Ga0115012_10186299 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300010155|Ga0098047_10195572 | Not Available | 776 | Open in IMG/M |
| 3300010883|Ga0133547_11403969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1318 | Open in IMG/M |
| 3300017715|Ga0181370_1004267 | Not Available | 1848 | Open in IMG/M |
| 3300017775|Ga0181432_1012209 | Not Available | 2112 | Open in IMG/M |
| 3300017775|Ga0181432_1206066 | Not Available | 617 | Open in IMG/M |
| 3300020243|Ga0211655_1014293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300020256|Ga0211645_1018653 | Not Available | 1179 | Open in IMG/M |
| 3300020277|Ga0211568_1078749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300020347|Ga0211504_1112800 | Not Available | 607 | Open in IMG/M |
| 3300020358|Ga0211689_1165282 | Not Available | 611 | Open in IMG/M |
| 3300020369|Ga0211709_10092692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300020389|Ga0211680_10288855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 610 | Open in IMG/M |
| 3300020399|Ga0211623_10055501 | Not Available | 1348 | Open in IMG/M |
| 3300020415|Ga0211553_10293504 | Not Available | 658 | Open in IMG/M |
| 3300020427|Ga0211603_10226382 | Not Available | 704 | Open in IMG/M |
| 3300021068|Ga0206684_1221014 | Not Available | 606 | Open in IMG/M |
| 3300021084|Ga0206678_10320475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 742 | Open in IMG/M |
| 3300021084|Ga0206678_10519491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 546 | Open in IMG/M |
| 3300021442|Ga0206685_10303991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 542 | Open in IMG/M |
| 3300021959|Ga0222716_10272357 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300021960|Ga0222715_10431494 | Not Available | 714 | Open in IMG/M |
| 3300025049|Ga0207898_1045232 | Not Available | 546 | Open in IMG/M |
| 3300025052|Ga0207906_1031721 | Not Available | 726 | Open in IMG/M |
| 3300025103|Ga0208013_1029216 | All Organisms → Viruses → Predicted Viral | 1583 | Open in IMG/M |
| 3300025128|Ga0208919_1252086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 512 | Open in IMG/M |
| 3300025133|Ga0208299_1202157 | Not Available | 588 | Open in IMG/M |
| 3300025268|Ga0207894_1078689 | Not Available | 561 | Open in IMG/M |
| 3300025776|Ga0208699_1038518 | Not Available | 554 | Open in IMG/M |
| 3300026074|Ga0208747_1061101 | Not Available | 807 | Open in IMG/M |
| 3300026210|Ga0208642_1081143 | Not Available | 712 | Open in IMG/M |
| 3300026213|Ga0208131_1137979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 579 | Open in IMG/M |
| 3300026253|Ga0208879_1288560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 600 | Open in IMG/M |
| 3300027700|Ga0209445_1203769 | Not Available | 537 | Open in IMG/M |
| 3300027838|Ga0209089_10246994 | Not Available | 1035 | Open in IMG/M |
| 3300027906|Ga0209404_10099124 | All Organisms → Viruses → Predicted Viral | 1721 | Open in IMG/M |
| 3300028190|Ga0257108_1125371 | Not Available | 753 | Open in IMG/M |
| 3300028190|Ga0257108_1153290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 668 | Open in IMG/M |
| 3300028192|Ga0257107_1040128 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300028192|Ga0257107_1096638 | Not Available | 884 | Open in IMG/M |
| 3300028488|Ga0257113_1155634 | Not Available | 685 | Open in IMG/M |
| 3300028489|Ga0257112_10142110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300028489|Ga0257112_10271868 | Not Available | 575 | Open in IMG/M |
| 3300028535|Ga0257111_1182023 | Not Available | 631 | Open in IMG/M |
| 3300031143|Ga0308025_1013532 | All Organisms → Viruses → Predicted Viral | 3319 | Open in IMG/M |
| 3300031644|Ga0308001_10150286 | Not Available | 952 | Open in IMG/M |
| 3300031695|Ga0308016_10036430 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
| 3300031696|Ga0307995_1163737 | Not Available | 815 | Open in IMG/M |
| 3300031757|Ga0315328_10292152 | Not Available | 952 | Open in IMG/M |
| 3300031757|Ga0315328_10636444 | Not Available | 607 | Open in IMG/M |
| 3300031851|Ga0315320_10252169 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300031886|Ga0315318_10127253 | Not Available | 1427 | Open in IMG/M |
| 3300032130|Ga0315333_10378111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 669 | Open in IMG/M |
| 3300032278|Ga0310345_10422059 | Not Available | 1261 | Open in IMG/M |
| 3300032820|Ga0310342_102089025 | Not Available | 678 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 37.38% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 11.21% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.35% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 8.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 5.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.74% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.87% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.87% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.87% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000140 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 500m | Environmental | Open in IMG/M |
| 3300000152 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500m | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005426 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005520 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 | Environmental | Open in IMG/M |
| 3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
| 3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
| 3300006416 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009008 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020243 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556050-ERR599055) | Environmental | Open in IMG/M |
| 3300020256 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556010-ERR599067) | Environmental | Open in IMG/M |
| 3300020277 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX556102-ERR599152) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020369 | Marine microbial communities from Tara Oceans - TARA_B100000446 (ERX556016-ERR599044) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020427 | Marine microbial communities from Tara Oceans - TARA_B000000460 (ERX555922-ERR598960) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025776 | Marine microbial communities from the Deep Pacific Ocean - MP2097 (SPAdes) | Environmental | Open in IMG/M |
| 3300026074 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026210 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 (SPAdes) | Environmental | Open in IMG/M |
| 3300026213 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes) | Environmental | Open in IMG/M |
| 3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300027700 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPfeb09P26500mDRAFT_10091242 | 3300000140 | Marine | MIILAYIIVAYALIGLLSMFFFIFFEEANNKLNEEYEDA* |
| LPjun08P12500mDRAFT_10149934 | 3300000152 | Marine | MIILAYIIVTFALIGLLSNFFFIFFEEANNELNKTEKEKKL* |
| LPjun09P12500mDRAFT_10133192 | 3300000222 | Marine | MIILAYIIVAYALIGLLSMFFFIFFEEANNKLNKEYEDA* |
| LP_A_09_P20_500DRAFT_10115165 | 3300000260 | Marine | MIILAYIIVAYALIGLLSMFFFIFFEEANDKLNKEYEDA* |
| JGI24006J15134_101245691 | 3300001450 | Marine | MIQTILAYTIVTLALIGLLSNFFFIFCMEANDKLNESI* |
| JGI24005J15628_101114111 | 3300001589 | Marine | MIQTILAYTIVTLALIGLCSNFFFIFCMEANDKLNESI* |
| GBIDBA_100265112 | 3300001683 | Hydrothermal Vent Plume | MIILAYTIVTFALIGLLSNFFFIFFEEANNELNKEYEDE* |
| GBIDBA_100470661 | 3300001683 | Hydrothermal Vent Plume | MIQTILATFIVSIAAIGLLSNFFFVFFMDANDKLNEEYEDA |
| Ga0066855_102834422 | 3300005402 | Marine | MTILAYIIVTYALIGLLSNFFFVFFMDANDKLNEEYENE* |
| Ga0066847_100291085 | 3300005426 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYKDD* |
| Ga0066851_100373834 | 3300005427 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYKDD* |
| Ga0066864_100448314 | 3300005520 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKPEKEKKL* |
| Ga0066381_101132802 | 3300005945 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDYK* |
| Ga0066369_100460883 | 3300005969 | Marine | MIQTILAYTIVTFALIGLLSNFFFIFFEEANNELNKDYKNE* |
| Ga0068469_11142911 | 3300006306 | Marine | AYIIVAYALIGLLSMFFFIFYEEANYKLNEEYEDA* |
| Ga0068471_12501702 | 3300006310 | Marine | MIILAYVIVAFALIGLLSNFFFIFFEEANNELNKEYEDE* |
| Ga0068471_15199794 | 3300006310 | Marine | MIILAYVIVTFALIGLLSNFFFIFFEEANNELNKEYEDA* |
| Ga0068471_15796933 | 3300006310 | Marine | MIILAYTIVTFALIGLLSNFFFVFFMDANDKLNEEYE* |
| Ga0068476_14761543 | 3300006324 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYEDA* |
| Ga0068480_12059004 | 3300006335 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDD* |
| Ga0068481_15767562 | 3300006339 | Marine | MIQTILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYEDA* |
| Ga0068481_15769635 | 3300006339 | Marine | MIILAYAIVTFALIGLLSNFFFVFFMDANDKLNEEYEDE* |
| Ga0068503_103403462 | 3300006340 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDYKDD* |
| Ga0068503_106299952 | 3300006340 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYEDE* |
| Ga0068493_102492402 | 3300006341 | Marine | MIILAYIIVTFALIGLLSNFFFIFFEEANNELNKEYEDE* |
| Ga0068493_106132234 | 3300006341 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANDELNKDYKDD* |
| Ga0099696_11344583 | 3300006346 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDYKDE* |
| Ga0100043_101443454 | 3300006416 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDYE* |
| Ga0098033_11123131 | 3300006736 | Marine | MIQTILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYEKAWQA |
| Ga0098048_12173092 | 3300006752 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANDKLNKEYEDAES* |
| Ga0098039_12122123 | 3300006753 | Marine | VEILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYEKA |
| Ga0098039_12718681 | 3300006753 | Marine | MIQTILAYAIVTFALIGLLSNFFFIFFEEANNELN |
| Ga0098054_10355481 | 3300006789 | Marine | IVTFALIGLLSNFFFIFFEEANDKLNKEYEDAES* |
| Ga0066376_104134273 | 3300006900 | Marine | MIQTILATFIVSIAAIGLLSNFFFVFFMDANDKLNEEYEDE* |
| Ga0098060_11216403 | 3300006921 | Marine | MIILAYAIVTFALIGLLSNFFFILFEEANNELNKEYKDD* |
| Ga0098057_10896441 | 3300006926 | Marine | MIQTILAYAIVTFALIGLLSNFFFIFFEEANNELNEE |
| Ga0066367_11294404 | 3300007291 | Marine | YIIVTFALIGLLSNFFFIFFEEANNELNKIENERI* |
| Ga0066367_11637752 | 3300007291 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYENE* |
| Ga0105011_10864953 | 3300007508 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYKDE* |
| Ga0102855_10257762 | 3300007647 | Estuarine | MIQTILAYTIVTLALIGLLSNFFFIFFMEANDKLN |
| Ga0102823_12183242 | 3300007692 | Estuarine | MILAYTIVTFALIGLLSNFFFIFFEEANNELNKEYKDD* |
| Ga0098052_12393273 | 3300008050 | Marine | MVEILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYEKAWQ |
| Ga0115658_10763813 | 3300008629 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKTKKEKKL* |
| Ga0115649_11315763 | 3300009008 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKTEKEKKL* |
| Ga0117902_12641341 | 3300009104 | Marine | ILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYKDE* |
| Ga0117902_13235551 | 3300009104 | Marine | MIILAYAIITFALIGLLSNFFFIFFEEANNELNKEYKDE* |
| Ga0114996_104270291 | 3300009173 | Marine | MIQTILATVIVSIAAIGLLSNFFFVFFMDANDKLNEEFIDV* |
| Ga0114996_108216932 | 3300009173 | Marine | MIQTILAYTIVTYALVGLLSMFFFIFFEEANNELNKKYEDE* |
| Ga0114993_103300593 | 3300009409 | Marine | MIQTILAYTIVTYALVGLLSMFFFIFFEEANNELNKEYEDA* |
| Ga0115011_101158496 | 3300009593 | Marine | MQILAYAIVTFALIGLLSNFFFIFFEEANNKLNEEFKDD* |
| Ga0105236_10477372 | 3300009619 | Marine Oceanic | MIILAYAIVTFALIGLLSNFFFIFFEEANNKLNKEYEND* |
| Ga0114999_110973541 | 3300009786 | Marine | TGPLQMIILAYIIVTYALIGLLSMFFFIFFEEANDKLNKEYEDA* |
| Ga0115012_101862995 | 3300009790 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEFKDD* |
| Ga0098047_101955721 | 3300010155 | Marine | ILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYE* |
| Ga0133547_114039695 | 3300010883 | Marine | MIQTILAYTIVTYALIGLLSMFFFIFFEEANNELNKEYKDE* |
| Ga0181370_10042672 | 3300017715 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEVNNELNKEYEKAWQATTI |
| Ga0181432_10122094 | 3300017775 | Seawater | MIILAYIIVTFALIGLLSNFFFIFFEEANNELNKEYKDD |
| Ga0181432_12060662 | 3300017775 | Seawater | MIQTILAYTIVTYALVGLLSMFFFIFFEEANNELNKDYE |
| Ga0211655_10142932 | 3300020243 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYKDD |
| Ga0211645_10186531 | 3300020256 | Marine | VEILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYKDD |
| Ga0211568_10787493 | 3300020277 | Marine | PLQMIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYKDD |
| Ga0211504_11128001 | 3300020347 | Marine | MIILAYIIVAYALIGLLSMFFFIFFEEANNKLNEEYEDA |
| Ga0211689_11652821 | 3300020358 | Marine | MIQTILAYTIVTLALIGLLSNFFFIFCMEANDKLN |
| Ga0211709_100926922 | 3300020369 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDYE |
| Ga0211680_102888553 | 3300020389 | Marine | MIQTILAYTIVTFALIGLLSNFFFVFFMDANDKLNEEYEDE |
| Ga0211623_100555014 | 3300020399 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDYK |
| Ga0211553_102935041 | 3300020415 | Marine | MIQTILAYTIVTFALIGLLSNFFFIFFEEANNELNKEYEDA |
| Ga0211603_102263823 | 3300020427 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYK |
| Ga0206684_12210143 | 3300021068 | Seawater | ITGPLQMIILAYIIVAYALIGLLSMFFFIFFEEANNKLNEEYEDA |
| Ga0206678_103204752 | 3300021084 | Seawater | MIILAYIIVAYALIGLLSMFFFIFFEEANNKLNEEYK |
| Ga0206678_105194912 | 3300021084 | Seawater | MIILAYIIVAYALIGLLSMFFFIFFEEANDKLNEEYKDA |
| Ga0206685_103039912 | 3300021442 | Seawater | MIILAYIIVTFALIGLLSNFFFVFFMDANDKLNEEYKDD |
| Ga0222716_102723572 | 3300021959 | Estuarine Water | MIILAYAIVTFALIGLLSNFFFVFFMDANDKLNEEYEDE |
| Ga0222715_104314941 | 3300021960 | Estuarine Water | MIILAYIIVTYALIGLLSMFFFVFFMDANDKLNEEY |
| Ga0207898_10452322 | 3300025049 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKTEKEKKL |
| Ga0207906_10317212 | 3300025052 | Marine | MIILAYAIVTFALIGLLSNFLFVFFMDANDKLNEEYEDE |
| Ga0208013_10292166 | 3300025103 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANDKLNKEYEDAES |
| Ga0208919_12520862 | 3300025128 | Marine | MIILAYIIVTYALIGLLSMFFFIFFEEANNKLNEEYEDA |
| Ga0208299_12021571 | 3300025133 | Marine | VEILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYEKAWQ |
| Ga0207894_10786893 | 3300025268 | Deep Ocean | ITGPLQMIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYKDD |
| Ga0208699_10385181 | 3300025776 | Deep Ocean | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNEEYEKAWQAC |
| Ga0208747_10611012 | 3300026074 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYEDA |
| Ga0208642_10811432 | 3300026210 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKPEKEKKL |
| Ga0208131_11379792 | 3300026213 | Marine | MTILAYIIVTYALIGLLSNFFFVFFMDANDKLNEEYENE |
| Ga0208879_12885602 | 3300026253 | Marine | MIQTILAYTIVTFALIGLLSNFFFIFFEEANNELNKDYKNE |
| Ga0209445_12037691 | 3300027700 | Marine | MIILAYAIVTFALIGLLSNFFFVFFMDANNKLNEEYEDE |
| Ga0209089_102469942 | 3300027838 | Marine | MIQTILAYTIVTFALIGLLSNFFFIFFEEANNELNKEYKDE |
| Ga0209404_100991242 | 3300027906 | Marine | MQILAYAIVTFALIGLLSNFFFIFFEEANNKLNEEFKDD |
| Ga0257108_11253711 | 3300028190 | Marine | MIQMILAYTIVTFALIGLLSNFFFIFFEEANNELNQSQSGGT |
| Ga0257108_11532902 | 3300028190 | Marine | MILAYAIVTFALIGLLSNFFFVFFEEANNELNKEYEDE |
| Ga0257107_10401282 | 3300028192 | Marine | MIILAYIIVTFALIGLLSNFFFIFFEEANNELNKTEKEKKL |
| Ga0257107_10966382 | 3300028192 | Marine | MIQTILAYTIVTYALVGLLSMFFFIFFEEANNELNKEYEDE |
| Ga0257113_11556342 | 3300028488 | Marine | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEYEDE |
| Ga0257112_101421103 | 3300028489 | Marine | SIIGGPLQMILAYAIVTFALIGLLSNFFFVFFEEANNELNKEYEDE |
| Ga0257112_102718682 | 3300028489 | Marine | MIILAYIIVTFALIGLLSNFFFIFFEEANNELNKDYKDD |
| Ga0257111_11820231 | 3300028535 | Marine | ITGPLQMIILAYIIVAYALIGLLSMFFFIFFEEANNKLNKEYEDA |
| Ga0308025_10135326 | 3300031143 | Marine | MIQTILAYTIVTLALVGLLSNFFFIFCMDANDKLNESI |
| Ga0308001_101502861 | 3300031644 | Marine | MIQTILAYTIVTLALIGLLSNFFFIFCMDANDKLN |
| Ga0308016_100364301 | 3300031695 | Marine | MIQTILAYTIVTLALIGLLSNFFFIFCMEANDKLNES |
| Ga0307995_11637371 | 3300031696 | Marine | MIQTILAYTIVTLAAIGLLSNFFFIFCMEANDKLNES |
| Ga0315328_102921523 | 3300031757 | Seawater | MIILAYIIVAYALIGLLSMFFFIFFEEANNKLNQSQND |
| Ga0315328_106364441 | 3300031757 | Seawater | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKDD |
| Ga0315320_102521691 | 3300031851 | Seawater | LQMIILAYIIVAYALIGLLSMFFFIFFEEANNKLNEEYEDA |
| Ga0315318_101272535 | 3300031886 | Seawater | ITGPLQMIILAYIIVAYALIGLLSMFFFIFFEEANNKLNEEYK |
| Ga0315333_103781112 | 3300032130 | Seawater | MIILAYAIVTFALIGLLSNFFFIFFEEANNELNKEFKDD |
| Ga0310345_104220594 | 3300032278 | Seawater | MIILAYIIVAYALIGLLSMFFFIFFEEANDKLNKEYEDA |
| Ga0310342_1020890251 | 3300032820 | Seawater | MIILAYIIVAYALIGLLSMFFFIFFEEANDKLNKEYED |
| ⦗Top⦘ |