


| Basic Information | |
|---|---|
| Family ID | F092164 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TARVTYRRLITAWTESVCADNPVEHYKDEWIGLPKADHPDF |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 93.46 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.617 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.019 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.430 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.80% β-sheet: 0.00% Coil/Unstructured: 94.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 6.54 |
| PF00903 | Glyoxalase | 4.67 |
| PF00583 | Acetyltransf_1 | 3.74 |
| PF04209 | HgmA_C | 2.80 |
| PF03781 | FGE-sulfatase | 2.80 |
| PF01979 | Amidohydro_1 | 1.87 |
| PF12802 | MarR_2 | 1.87 |
| PF08450 | SGL | 1.87 |
| PF03401 | TctC | 0.93 |
| PF08238 | Sel1 | 0.93 |
| PF00190 | Cupin_1 | 0.93 |
| PF01063 | Aminotran_4 | 0.93 |
| PF13432 | TPR_16 | 0.93 |
| PF03795 | YCII | 0.93 |
| PF04299 | FMN_bind_2 | 0.93 |
| PF00078 | RVT_1 | 0.93 |
| PF02775 | TPP_enzyme_C | 0.93 |
| PF06742 | DUF1214 | 0.93 |
| PF07681 | DoxX | 0.93 |
| PF06983 | 3-dmu-9_3-mt | 0.93 |
| PF14659 | Phage_int_SAM_3 | 0.93 |
| PF13620 | CarboxypepD_reg | 0.93 |
| PF02371 | Transposase_20 | 0.93 |
| PF01694 | Rhomboid | 0.93 |
| PF00656 | Peptidase_C14 | 0.93 |
| PF13808 | DDE_Tnp_1_assoc | 0.93 |
| PF00285 | Citrate_synt | 0.93 |
| PF13751 | DDE_Tnp_1_6 | 0.93 |
| PF01872 | RibD_C | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF11776 | RcnB | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF00291 | PALP | 0.93 |
| PF03466 | LysR_substrate | 0.93 |
| PF03734 | YkuD | 0.93 |
| PF00561 | Abhydrolase_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 2.80 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.80 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.87 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.87 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.87 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.93 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.93 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.93 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.93 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.93 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.93 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.93 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.93 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.93 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.62 % |
| Unclassified | root | N/A | 37.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908029|A2_v1_NODE_21888_len_1834_cov_17_016903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1884 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101015154 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101272540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300003992|Ga0055470_10244208 | Not Available | 500 | Open in IMG/M |
| 3300004268|Ga0066398_10224613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300005294|Ga0065705_10369497 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005363|Ga0008090_10065442 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1336 | Open in IMG/M |
| 3300005434|Ga0070709_10664479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300005444|Ga0070694_101755301 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005534|Ga0070735_10834955 | Not Available | 542 | Open in IMG/M |
| 3300005545|Ga0070695_100780965 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005549|Ga0070704_100295688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300005563|Ga0068855_101332749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300005618|Ga0068864_101470388 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005993|Ga0080027_10481021 | Not Available | 504 | Open in IMG/M |
| 3300005995|Ga0066790_10367394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300006031|Ga0066651_10805956 | Not Available | 510 | Open in IMG/M |
| 3300006052|Ga0075029_101125135 | Not Available | 546 | Open in IMG/M |
| 3300006354|Ga0075021_10924420 | Not Available | 567 | Open in IMG/M |
| 3300006797|Ga0066659_11211017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300006914|Ga0075436_100887393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L56 | 666 | Open in IMG/M |
| 3300007788|Ga0099795_10079160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1254 | Open in IMG/M |
| 3300009012|Ga0066710_102815222 | Not Available | 687 | Open in IMG/M |
| 3300009098|Ga0105245_10491558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 1242 | Open in IMG/M |
| 3300009143|Ga0099792_10282358 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300009156|Ga0111538_12194173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 694 | Open in IMG/M |
| 3300009609|Ga0105347_1055648 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300009683|Ga0116224_10499825 | Not Available | 580 | Open in IMG/M |
| 3300009683|Ga0116224_10503542 | Not Available | 577 | Open in IMG/M |
| 3300010358|Ga0126370_10123992 | Not Available | 1837 | Open in IMG/M |
| 3300010358|Ga0126370_10135242 | Not Available | 1772 | Open in IMG/M |
| 3300010359|Ga0126376_11650364 | Not Available | 675 | Open in IMG/M |
| 3300010361|Ga0126378_13272675 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010362|Ga0126377_12291115 | Not Available | 616 | Open in IMG/M |
| 3300010366|Ga0126379_12935998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300010371|Ga0134125_10033084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5760 | Open in IMG/M |
| 3300010398|Ga0126383_10044459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3653 | Open in IMG/M |
| 3300010403|Ga0134123_10630155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300011403|Ga0137313_1035468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 838 | Open in IMG/M |
| 3300011415|Ga0137325_1055856 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012096|Ga0137389_11110037 | Not Available | 678 | Open in IMG/M |
| 3300012199|Ga0137383_10950984 | Not Available | 627 | Open in IMG/M |
| 3300012199|Ga0137383_11046188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sGM-13 | 593 | Open in IMG/M |
| 3300012200|Ga0137382_10728065 | Not Available | 711 | Open in IMG/M |
| 3300012202|Ga0137363_10878651 | Not Available | 761 | Open in IMG/M |
| 3300012202|Ga0137363_10996396 | Not Available | 712 | Open in IMG/M |
| 3300012205|Ga0137362_10662898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300012205|Ga0137362_10817018 | Not Available | 798 | Open in IMG/M |
| 3300012205|Ga0137362_11609980 | Not Available | 536 | Open in IMG/M |
| 3300012210|Ga0137378_11710682 | Not Available | 535 | Open in IMG/M |
| 3300012285|Ga0137370_10335107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300012469|Ga0150984_115694868 | Not Available | 579 | Open in IMG/M |
| 3300012917|Ga0137395_10884076 | Not Available | 647 | Open in IMG/M |
| 3300012918|Ga0137396_10301926 | Not Available | 1184 | Open in IMG/M |
| 3300014878|Ga0180065_1128594 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300015371|Ga0132258_10680065 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300015371|Ga0132258_10916462 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300015374|Ga0132255_105422155 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300016270|Ga0182036_11507225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300016341|Ga0182035_10181666 | Not Available | 1647 | Open in IMG/M |
| 3300016341|Ga0182035_11925103 | Not Available | 536 | Open in IMG/M |
| 3300016371|Ga0182034_10081640 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300016404|Ga0182037_11541322 | Not Available | 590 | Open in IMG/M |
| 3300016445|Ga0182038_11234625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300017927|Ga0187824_10036708 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300017932|Ga0187814_10142002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 894 | Open in IMG/M |
| 3300017970|Ga0187783_10822670 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300018001|Ga0187815_10197830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300018007|Ga0187805_10545116 | Not Available | 546 | Open in IMG/M |
| 3300018466|Ga0190268_11983860 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018468|Ga0066662_11137977 | Not Available | 784 | Open in IMG/M |
| 3300018481|Ga0190271_12488817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300020581|Ga0210399_10541789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 966 | Open in IMG/M |
| 3300021178|Ga0210408_10784456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300021180|Ga0210396_10452967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga | 1126 | Open in IMG/M |
| 3300021363|Ga0193699_10029834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2037 | Open in IMG/M |
| 3300021861|Ga0213853_10056839 | Not Available | 571 | Open in IMG/M |
| 3300025930|Ga0207701_10883236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 749 | Open in IMG/M |
| 3300025949|Ga0207667_10845627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300026281|Ga0209863_10248307 | Not Available | 510 | Open in IMG/M |
| 3300026359|Ga0257163_1047548 | Not Available | 683 | Open in IMG/M |
| 3300026374|Ga0257146_1059286 | Not Available | 620 | Open in IMG/M |
| 3300026499|Ga0257181_1064058 | Not Available | 624 | Open in IMG/M |
| 3300028379|Ga0268266_11234201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300028800|Ga0265338_10116655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2138 | Open in IMG/M |
| 3300029636|Ga0222749_10211998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300029987|Ga0311334_11251778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300031231|Ga0170824_104042830 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031561|Ga0318528_10562162 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium | 612 | Open in IMG/M |
| 3300031572|Ga0318515_10219689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1019 | Open in IMG/M |
| 3300031744|Ga0306918_11016434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300031744|Ga0306918_11213094 | Not Available | 582 | Open in IMG/M |
| 3300031744|Ga0306918_11268689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 567 | Open in IMG/M |
| 3300031805|Ga0318497_10375963 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031890|Ga0306925_11425654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300031893|Ga0318536_10042724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2165 | Open in IMG/M |
| 3300031912|Ga0306921_12470732 | Not Available | 540 | Open in IMG/M |
| 3300031947|Ga0310909_11259513 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031954|Ga0306926_12456742 | Not Available | 573 | Open in IMG/M |
| 3300031996|Ga0308176_12280680 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300032001|Ga0306922_11554324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300032052|Ga0318506_10513312 | Not Available | 531 | Open in IMG/M |
| 3300032076|Ga0306924_11843157 | Not Available | 629 | Open in IMG/M |
| 3300032091|Ga0318577_10478148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300032160|Ga0311301_11902505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300032205|Ga0307472_101946078 | Not Available | 588 | Open in IMG/M |
| 3300033289|Ga0310914_11373155 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.74% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_v1_00217030 | 2124908029 | Soil | LSVLVTYRSVLTPWQEQVCAENPVEHYEGEWIGLPGLFNALY |
| JGIcombinedJ26739_1010151541 | 3300002245 | Forest Soil | LSVLVTYRHLFTPWQEQVCAENPVDHYEGEWIGLPRADHPDF* |
| JGIcombinedJ26739_1012725402 | 3300002245 | Forest Soil | LVTYRSVLTPWQEQVCAENPVEHYEGEWIGLPRANDPDF* |
| Ga0055470_102442081 | 3300003992 | Natural And Restored Wetlands | QPLTARVTYRRVLTDWEEDVCADNPNEYYKDEWIGLPKAERPDF* |
| Ga0066398_102246132 | 3300004268 | Tropical Forest Soil | LTARVTYRRLITEWQESVCADNPIEHYEGEWIGLPKADHPDF* |
| Ga0065705_103694971 | 3300005294 | Switchgrass Rhizosphere | TAPLTVRVTYRRLITDYQENVCADNPTEHYKDEWIGLPRADRPDF* |
| Ga0008090_100654421 | 3300005363 | Tropical Rainforest Soil | RITYRRVISQWEESVCADNPIEHYLGEWIGLPSAEHPDF* |
| Ga0070709_106644792 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QPLTGVVTYRPLTVGWREDVCADNPVEHYKDEWVGLPKAEHPDF* |
| Ga0070694_1017553011 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VFTQPLTVVVTYRPMTIGWREAVCADNPVEHYKDEWIGLPKANHPDF* |
| Ga0070735_108349551 | 3300005534 | Surface Soil | VFVMPLTARITYRRVISRWEESVCADNPTEHYPGEWIGLPRAERPDF* |
| Ga0070695_1007809651 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RVTYRRLRTQLEENVCADNPMEHYPGEWIGLPRSDRPDF* |
| Ga0070704_1002956883 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVVTYRPMTIGWRETVCADNPVEHYKDEWIGLPKAERPDF* |
| Ga0068855_1013327491 | 3300005563 | Corn Rhizosphere | LTARVTYRRVVTDLTKSVCADNPMEHYPGEWISLPKADRPDF* |
| Ga0068864_1014703881 | 3300005618 | Switchgrass Rhizosphere | QPLTARVTYRRVTSDWSESVCADNPQEHYKDEWIGLPRAARADF* |
| Ga0080027_104810212 | 3300005993 | Prmafrost Soil | ARVTYRRVISQWQEALCAENPVEHYPGEWAGLPRAERPDF* |
| Ga0066790_103673942 | 3300005995 | Soil | VFAAPLSVLVTYRSVLTPWQEQVCAENPVEHYEGEWIGLPRANDPDF* |
| Ga0066651_108059562 | 3300006031 | Soil | TARVTYRRLISEWAESVCAENPVEHYKDEWIGLPKADHPDF* |
| Ga0075029_1011251351 | 3300006052 | Watersheds | YRRTLRQWEEQVCAENPADYYKDQWIGLPKADHPDF* |
| Ga0075021_109244201 | 3300006354 | Watersheds | FTAPLTARVTYRRVVTQWTESVCADNPTEHYKDEWIGLPKADRPDF* |
| Ga0066659_112110171 | 3300006797 | Soil | RVTYRRLITEWREAVCAENPVEHYKDEWIGLPKADRPDF* |
| Ga0075436_1008873932 | 3300006914 | Populus Rhizosphere | VVTYRPMTIGWREAVCADNPFEHYKDEWVGLPKADHPDF* |
| Ga0099795_100791601 | 3300007788 | Vadose Zone Soil | RVTYRRVTTEWQESVCVEDPTEHYEGEWIGLPRADHPDF* |
| Ga0066710_1028152223 | 3300009012 | Grasslands Soil | VFTAPLTARVTYRRLINEWAEAVCAENPVEHYKDEWIGLPKADRPDF |
| Ga0105245_104915581 | 3300009098 | Miscanthus Rhizosphere | MPLTARVTYRRVTSQWSESVCADNPQEHYKDEWIGLPRADKPDF* |
| Ga0099792_102823582 | 3300009143 | Vadose Zone Soil | VTYLRVTTEWQESVCVEDPTEHYEGEWIGLPRADHPDF* |
| Ga0111538_121941732 | 3300009156 | Populus Rhizosphere | WRLISERTEAVCADNPVEHYKDEWIGLPRADRPDF* |
| Ga0105347_10556483 | 3300009609 | Soil | PKMLTGPWTVRVTYRRLNSVWAENVCADNPVEHYKDEWIGLPRAERADF* |
| Ga0116224_104998252 | 3300009683 | Peatlands Soil | YRRVITSWSESVCADNPVEHYKDEWIGLPKADRPDF* |
| Ga0116224_105035421 | 3300009683 | Peatlands Soil | VLVTYRRLLTPWQEQVCAENPVEHYEGEWIGLPRADDLDF* |
| Ga0126370_101239921 | 3300010358 | Tropical Forest Soil | RLMTEWQEQVCADNPVEHYKDEWIGLPTANHPDF* |
| Ga0126370_101352423 | 3300010358 | Tropical Forest Soil | TYRRLMTEWQEGVCADNPVEHYKDEWIGLPKADHADF* |
| Ga0126376_116503642 | 3300010359 | Tropical Forest Soil | RRLMTEWQEQVCADNPVEHYKDEWIGLPTANRPDF* |
| Ga0126378_132726751 | 3300010361 | Tropical Forest Soil | RPLISQWQEAVCADNPIDHYPGEWIGLPRAERPDF* |
| Ga0126377_122911151 | 3300010362 | Tropical Forest Soil | YVTYRPLTNRWTEQVCAENPVEHYANEWVGLPKDEKPDF* |
| Ga0126379_129359982 | 3300010366 | Tropical Forest Soil | VLVTYRRLITEWQEQVCAENPVEYYKDQWIGLPKADHPDF* |
| Ga0134125_100330841 | 3300010371 | Terrestrial Soil | LTARVTYRRAVTDLTKSVCADNPMEHYPGEWISLPKADRPDF* |
| Ga0126383_100444591 | 3300010398 | Tropical Forest Soil | TYRRLMTEWQEQVCAENPVEYYKDQWIGLPKADQPDF* |
| Ga0134123_106301552 | 3300010403 | Terrestrial Soil | VTYRRLASQWAENVCPDNPVEHYKDEWIGLPRAERADF* |
| Ga0137313_10354681 | 3300011403 | Soil | RRLISERTEAVCADNPVEHYKDEWVGLPRADGPDF* |
| Ga0137325_10558562 | 3300011415 | Soil | TAPLTARVTYRRLISERTEAVCADNPVEHYKDEWVGLPRADRPDF* |
| Ga0137389_111100372 | 3300012096 | Vadose Zone Soil | VTYRHLITQWQEQLCADNPDEHYKDEWIGLPKANHPDF* |
| Ga0137383_109509841 | 3300012199 | Vadose Zone Soil | VLVTYRRLMTEWQEGVCADNPVEHYKDEWVGLPRADRPDF* |
| Ga0137383_110461882 | 3300012199 | Vadose Zone Soil | MIRFTAPLTARVTYRRLITEWTESVCADNPVEHYKDEWIGLP |
| Ga0137382_107280651 | 3300012200 | Vadose Zone Soil | RVTYRRLITRWMETVCAENSVEHYEGEWIGLPKADRPDF* |
| Ga0137363_108786512 | 3300012202 | Vadose Zone Soil | TARVTYRRLITAWTESVCADNPVEHYKDEWIGLPKADHPDF* |
| Ga0137363_109963962 | 3300012202 | Vadose Zone Soil | MIRFTAPLTARVTYRRLITEWTESVCADNPVEHYKDEWIGLPKADHRDF* |
| Ga0137362_106628983 | 3300012205 | Vadose Zone Soil | VTYRRLITRWTETVCAENSVEHYEDEWIGLPKADRPDF* |
| Ga0137362_108170181 | 3300012205 | Vadose Zone Soil | TYRRVTTEWQESVCVEDPTEHYEGEWIGLPRADHPDF* |
| Ga0137362_116099801 | 3300012205 | Vadose Zone Soil | MIRFTAPLTARVTYRRLITQWTEAVCAENPVEHYQDEWIGLPKADRPDF* |
| Ga0137378_117106822 | 3300012210 | Vadose Zone Soil | VTYRRVITEWAEDVCADNPNEYYKDEWIGLPKAERPDF* |
| Ga0137370_103351071 | 3300012285 | Vadose Zone Soil | VVTYRRLTFGWREDVCADNPVEHYKDEWIGLPTATHPDF* |
| Ga0150984_1156948682 | 3300012469 | Avena Fatua Rhizosphere | VTYRRVVTGWSESVCADNPMEHYKDEWIGLPRAERPDF* |
| Ga0137395_108840761 | 3300012917 | Vadose Zone Soil | LTAPLTVLVTYRRLMTEWQEQVCADNPVEHYKDEWIGLPTAAHPDF* |
| Ga0137396_103019261 | 3300012918 | Vadose Zone Soil | RRLMTEWQEQVCADNPVEHYKDEWIGLPTANYPDF* |
| Ga0180065_11285942 | 3300014878 | Soil | LTVRVTYRRLITDFQENVCADNPVEHYKDEWVGLPRADGPDF* |
| Ga0132258_106800651 | 3300015371 | Arabidopsis Rhizosphere | AVVTYRPMYIGWREAVCADNPVEHYKDEWVGLPKADRPDF* |
| Ga0132258_109164621 | 3300015371 | Arabidopsis Rhizosphere | LTARVTYRRLISQWNESVCAENPMEHYEGEWVGLPKAERPDF* |
| Ga0132255_1054221551 | 3300015374 | Arabidopsis Rhizosphere | RVTSEWSESVCADNPQEHYKDEWIGLPRAARADF* |
| Ga0182036_115072252 | 3300016270 | Soil | TYRRLITEWQEQVCAENPVEYYKDQWIGLPKADQPDF |
| Ga0182035_101816662 | 3300016341 | Soil | LSVLVTYRRLLLPWHVQVCAENPLAHYEGEWIGLPRANHPDF |
| Ga0182035_119251031 | 3300016341 | Soil | ARVTYRRVTTEWQESVCVEDPTEHYEGEWIGLPRADHPDF |
| Ga0182034_100816404 | 3300016371 | Soil | VTYRRLIAEWQENICADNPVEYYKDEWIGLPKADHADF |
| Ga0182037_115413222 | 3300016404 | Soil | LVTYRRLLLPWQEQVCAENPVEHYEGEWIGLPRANHPDF |
| Ga0182038_112346252 | 3300016445 | Soil | LVTYRRLITEWQEQVCAENPVEYYKDQWIGLPKADQPDF |
| Ga0187824_100367084 | 3300017927 | Freshwater Sediment | FTQPLTARVTYRRVTSEWSEEVCADNPVDHYKDEWIGLPRAGHPDF |
| Ga0187814_101420022 | 3300017932 | Freshwater Sediment | LVTYRRLLRPWEEQVCAENPVEHYEGEWIGLPRANDPDF |
| Ga0187783_108226701 | 3300017970 | Tropical Peatland | PLTVLVTYRRLIAHWQEDICADNPVEYYKDQWIGLPKAEDLDF |
| Ga0187815_101978302 | 3300018001 | Freshwater Sediment | YRPLITRWQESVCADNPEEHYKDEWIGLPRADRPDF |
| Ga0187805_105451162 | 3300018007 | Freshwater Sediment | TYRRLISEWQESVCADNPVEHYKDEWIGLPKADRSDF |
| Ga0190268_119838602 | 3300018466 | Soil | PWTMRVTYRRLASQWAENVCADNPVEHYKDEWIGLPRADRADF |
| Ga0066662_111379773 | 3300018468 | Grasslands Soil | MIRFTAPLTARVTYRRLITEWTESVCADNPVEHYKDEWIGLPKADHRDF |
| Ga0190271_124888171 | 3300018481 | Soil | RRLTSQWAENVCADNPVEHYKDEWIGLPRAERTDF |
| Ga0210399_105417892 | 3300020581 | Soil | VTARVTYRRVISQWQESVCAENPMEYYPGEWVGLPRADRPDSCLSAES |
| Ga0210408_107844562 | 3300021178 | Soil | TYRALITQWQESVCADNPVEHYEGEWIGLPKADRPDF |
| Ga0210396_104529672 | 3300021180 | Soil | TYRPLISRWQESVCADNPMEHYKGEWIGLPTADHLDF |
| Ga0193699_100298344 | 3300021363 | Soil | TARVTYRRLMTNWTESVCADNPMEHYKDEWIGLPKADRPDF |
| Ga0213853_100568391 | 3300021861 | Watersheds | TYRRTLRQWEEQVCAENPADYYKDQWIGLPKADHPDF |
| Ga0207701_108832362 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QPWTARVTYRRLISEWSESVCADNPQEHYKDEWIGLPRATRADF |
| Ga0207667_108456272 | 3300025949 | Corn Rhizosphere | FTQPLTGVVTYRPMTIGWREAVCADNPVQHYKGEWVGLPQAPHPDF |
| Ga0209863_102483072 | 3300026281 | Prmafrost Soil | LTARVTYRRVISQWQEALCAENPVEHYPGEWAGLPRAERPDF |
| Ga0257163_10475482 | 3300026359 | Soil | VLVTYRRLMTEWQEQVCADNPVEHYKDEWIGLPTAAHPDF |
| Ga0257146_10592862 | 3300026374 | Soil | TARVTYRRVTTEWQESVCVEDPTEHYEGEWIGLPRADHPDF |
| Ga0257181_10640582 | 3300026499 | Soil | VTYRRLMTEWQEQVCADNPVEHYKDEWIGLPTAAHPDF |
| Ga0268266_112342011 | 3300028379 | Switchgrass Rhizosphere | VTYRRLATERTEAVCADNPVEHYKDEWIGLPRSDRPDF |
| Ga0265338_101166551 | 3300028800 | Rhizosphere | RVTYRRVVSEWAESVCADNPMEHYKDEWIGLPRAARPDF |
| Ga0222749_102119981 | 3300029636 | Soil | FTAPLTARVTYRPVTTEWQESVCVEDPTEHYEGEWIGLPRADHPDF |
| Ga0311334_112517781 | 3300029987 | Fen | FTGPLTVRVTYRRLTTDWQEQVCADNPVEHYKDEWIGLPVANHPDF |
| Ga0170824_1040428302 | 3300031231 | Forest Soil | PKVFTAPLTARVTYRRVISEWSESVCADNPQEHYKDEWIGLPRANRPDF |
| Ga0318528_105621621 | 3300031561 | Soil | PWTVRVDYRRLRSFWPENVCADNPVEHYKDEWIGLPRAEHPDF |
| Ga0318515_102196891 | 3300031572 | Soil | PWTARVTYRRLISEWAESVCADNPVEHYKDEWIGLPKADHADF |
| Ga0306918_110164342 | 3300031744 | Soil | TVFVMPLTARITYRRVISQWEESVCADNPIEHYPGEWIGLPSAEHPDF |
| Ga0306918_112130941 | 3300031744 | Soil | LTARVTYRPLISQWQESVCADNPVEHYKDEWIGLPNADRPDF |
| Ga0306918_112686892 | 3300031744 | Soil | KVFTMPWTARVTYRRLISEWAESVCADNPVEHYKDEWIGLPKADHADF |
| Ga0318497_103759632 | 3300031805 | Soil | FNAPFTARVTYRPLISQWQETVCADNPVDHYPGEWIGLPRAERSDF |
| Ga0306925_114256542 | 3300031890 | Soil | PLTVLVTYRRLITEWQEQVCAENPVEYYKDQWIGLPKADQPDF |
| Ga0318536_100427241 | 3300031893 | Soil | VFNAPFTARVTYRPLISQWQETVCADNPVDHYPGEWIGLPRAERSDF |
| Ga0306921_124707321 | 3300031912 | Soil | LTARITYRRVISQWEESVCADNPIEHYPGEWIGLPRAEHPDF |
| Ga0310909_112595132 | 3300031947 | Soil | TARVTYRPLISQWQETVCADNPVDHYPGEWIGLPRAERADF |
| Ga0306926_124567421 | 3300031954 | Soil | ARVTYRPLISQWQESVCADNPMEHYPGEWIGMPKADHADF |
| Ga0308176_122806802 | 3300031996 | Soil | TARVTYRRVTSEWSESVCADNPQEHYKDEWIGLPRATRADF |
| Ga0306922_115543242 | 3300032001 | Soil | RVTYRRVTSQWQEAVCADNPMEHYEGEWAGLPKADRPDF |
| Ga0318506_105133121 | 3300032052 | Soil | NVFAEPLSVLVTYRRLLLPWQEQVCAENPVEHYEGEWIGLPRANHPDF |
| Ga0306924_118431572 | 3300032076 | Soil | TARITYRRVISTWQESVCAENPTDHYPGEWIGLPRAEHPDF |
| Ga0318577_104781482 | 3300032091 | Soil | RVTYRRLISEWAESVCADNPVEHYKDEWIGLPKADHADF |
| Ga0311301_119025052 | 3300032160 | Peatlands Soil | TAPLTVLVTYRRLITQWQQEICADNPGEYYKDQWIGLPRAEHPDF |
| Ga0307472_1019460781 | 3300032205 | Hardwood Forest Soil | PWTARVTYRRVKTDWSEDVCAENPMEHYPGEWIGLPRANRPDF |
| Ga0310914_113731552 | 3300033289 | Soil | KVFNAPFTARVTYRPLISQWQETVCADNPVDHYPGEWIGLPRVERADF |
| ⦗Top⦘ |