


| Basic Information | |
|---|---|
| Family ID | F092100 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADS |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 67.29 % |
| % of genes from short scaffolds (< 2000 bps) | 69.16 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (26.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.879 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.52% β-sheet: 0.00% Coil/Unstructured: 93.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF08299 | Bac_DnaA_C | 40.19 |
| PF11638 | DnaA_N | 16.82 |
| PF00712 | DNA_pol3_beta | 9.35 |
| PF02767 | DNA_pol3_beta_2 | 9.35 |
| PF01649 | Ribosomal_S20p | 4.67 |
| PF03109 | ABC1 | 3.74 |
| PF02768 | DNA_pol3_beta_3 | 3.74 |
| PF13476 | AAA_23 | 2.80 |
| PF06831 | H2TH | 1.87 |
| PF02954 | HTH_8 | 1.87 |
| PF01751 | Toprim | 0.93 |
| PF02463 | SMC_N | 0.93 |
| PF04127 | DFP | 0.93 |
| PF01475 | FUR | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF00899 | ThiF | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 40.19 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 22.43 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 4.67 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 3.74 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 0.93 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.88 % |
| Unclassified | root | N/A | 41.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10026519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2902 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1047238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300001347|JGI20156J14371_10005212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 9105 | Open in IMG/M |
| 3300001347|JGI20156J14371_10143238 | Not Available | 679 | Open in IMG/M |
| 3300001349|JGI20160J14292_10023638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3377 | Open in IMG/M |
| 3300001352|JGI20157J14317_10178168 | Not Available | 628 | Open in IMG/M |
| 3300001355|JGI20158J14315_10194079 | Not Available | 584 | Open in IMG/M |
| 3300003345|JGI26080J50196_1003809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 5660 | Open in IMG/M |
| 3300003345|JGI26080J50196_1003932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 5543 | Open in IMG/M |
| 3300003427|JGI26084J50262_1002662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 9162 | Open in IMG/M |
| 3300003427|JGI26084J50262_1004893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 6177 | Open in IMG/M |
| 3300003620|JGI26273J51734_10196195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 509 | Open in IMG/M |
| 3300004279|Ga0066605_10021479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3203 | Open in IMG/M |
| 3300004279|Ga0066605_10207394 | Not Available | 749 | Open in IMG/M |
| 3300004279|Ga0066605_10236475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300005837|Ga0078893_10354935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1081 | Open in IMG/M |
| 3300006026|Ga0075478_10005281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4506 | Open in IMG/M |
| 3300006027|Ga0075462_10011046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2916 | Open in IMG/M |
| 3300006402|Ga0075511_1043653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1599 | Open in IMG/M |
| 3300006425|Ga0075486_1816555 | Not Available | 560 | Open in IMG/M |
| 3300006637|Ga0075461_10070143 | Not Available | 1121 | Open in IMG/M |
| 3300006874|Ga0075475_10013636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4063 | Open in IMG/M |
| 3300007234|Ga0075460_10041698 | Not Available | 1748 | Open in IMG/M |
| 3300007234|Ga0075460_10129581 | Not Available | 890 | Open in IMG/M |
| 3300007623|Ga0102948_1000029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 51080 | Open in IMG/M |
| 3300007992|Ga0105748_10218545 | Not Available | 795 | Open in IMG/M |
| 3300009071|Ga0115566_10002779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 14327 | Open in IMG/M |
| 3300009142|Ga0102885_1042200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300009172|Ga0114995_10169282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1217 | Open in IMG/M |
| 3300009193|Ga0115551_1452706 | Not Available | 549 | Open in IMG/M |
| 3300009426|Ga0115547_1076157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1134 | Open in IMG/M |
| 3300009437|Ga0115556_1010037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 5198 | Open in IMG/M |
| 3300009440|Ga0115561_1120968 | Not Available | 1053 | Open in IMG/M |
| 3300009442|Ga0115563_1220462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 719 | Open in IMG/M |
| 3300009443|Ga0115557_1211356 | Not Available | 756 | Open in IMG/M |
| 3300009445|Ga0115553_1367659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 549 | Open in IMG/M |
| 3300009467|Ga0115565_10016457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4031 | Open in IMG/M |
| 3300009476|Ga0115555_1193594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 840 | Open in IMG/M |
| 3300009495|Ga0115571_1259820 | Not Available | 696 | Open in IMG/M |
| 3300009498|Ga0115568_10161179 | Not Available | 1060 | Open in IMG/M |
| 3300009505|Ga0115564_10351503 | Not Available | 728 | Open in IMG/M |
| 3300009505|Ga0115564_10391787 | Not Available | 680 | Open in IMG/M |
| 3300009505|Ga0115564_10397948 | Not Available | 673 | Open in IMG/M |
| 3300010299|Ga0129342_1316995 | Not Available | 534 | Open in IMG/M |
| 3300012969|Ga0129332_1484910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300013010|Ga0129327_10562767 | Not Available | 625 | Open in IMG/M |
| 3300017818|Ga0181565_10386731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 925 | Open in IMG/M |
| 3300017818|Ga0181565_10885148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 557 | Open in IMG/M |
| 3300017824|Ga0181552_10129633 | Not Available | 1365 | Open in IMG/M |
| 3300017949|Ga0181584_10062715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2599 | Open in IMG/M |
| 3300017950|Ga0181607_10282289 | Not Available | 940 | Open in IMG/M |
| 3300017950|Ga0181607_10571566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300017950|Ga0181607_10651239 | Not Available | 550 | Open in IMG/M |
| 3300017952|Ga0181583_10280232 | Not Available | 1066 | Open in IMG/M |
| 3300017957|Ga0181571_10497369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 746 | Open in IMG/M |
| 3300017958|Ga0181582_10554794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 708 | Open in IMG/M |
| 3300017968|Ga0181587_10072324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2512 | Open in IMG/M |
| 3300017968|Ga0181587_10175098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1499 | Open in IMG/M |
| 3300018036|Ga0181600_10182514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1136 | Open in IMG/M |
| 3300018036|Ga0181600_10538752 | Not Available | 550 | Open in IMG/M |
| 3300018039|Ga0181579_10303170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300018417|Ga0181558_10038531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3330 | Open in IMG/M |
| 3300019283|Ga0182058_1327762 | Not Available | 1711 | Open in IMG/M |
| 3300019751|Ga0194029_1007460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1510 | Open in IMG/M |
| 3300019756|Ga0194023_1008857 | Not Available | 2016 | Open in IMG/M |
| 3300019765|Ga0194024_1011452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1856 | Open in IMG/M |
| 3300020052|Ga0181554_1057452 | Not Available | 2057 | Open in IMG/M |
| 3300020166|Ga0206128_1068961 | Not Available | 1634 | Open in IMG/M |
| 3300020174|Ga0181603_10160152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 967 | Open in IMG/M |
| 3300020175|Ga0206124_10006119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 7729 | Open in IMG/M |
| 3300020404|Ga0211659_10351813 | Not Available | 643 | Open in IMG/M |
| 3300020469|Ga0211577_10005986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 10448 | Open in IMG/M |
| 3300021085|Ga0206677_10310138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 627 | Open in IMG/M |
| 3300021185|Ga0206682_10362695 | Not Available | 619 | Open in IMG/M |
| 3300021323|Ga0210295_1185260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300021957|Ga0222717_10091113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1915 | Open in IMG/M |
| 3300021959|Ga0222716_10085535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2156 | Open in IMG/M |
| 3300022900|Ga0255771_1031038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3295 | Open in IMG/M |
| 3300022905|Ga0255756_1001940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 22763 | Open in IMG/M |
| 3300022909|Ga0255755_1076975 | Not Available | 1526 | Open in IMG/M |
| 3300022926|Ga0255753_1288976 | Not Available | 640 | Open in IMG/M |
| 3300022928|Ga0255758_10032430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3273 | Open in IMG/M |
| 3300022929|Ga0255752_10036954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3239 | Open in IMG/M |
| 3300023172|Ga0255766_10329749 | Not Available | 765 | Open in IMG/M |
| 3300023273|Ga0255763_1347713 | Not Available | 508 | Open in IMG/M |
| 3300023706|Ga0232123_1014319 | Not Available | 1710 | Open in IMG/M |
| 3300024293|Ga0228651_1103726 | Not Available | 644 | Open in IMG/M |
| (restricted) 3300024324|Ga0233443_1315565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300024335|Ga0228672_1150391 | Not Available | 604 | Open in IMG/M |
| 3300025594|Ga0209094_1110383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300025610|Ga0208149_1081423 | Not Available | 797 | Open in IMG/M |
| 3300025630|Ga0208004_1145678 | Not Available | 516 | Open in IMG/M |
| 3300025636|Ga0209136_1044988 | Not Available | 1524 | Open in IMG/M |
| 3300025653|Ga0208428_1020382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2190 | Open in IMG/M |
| 3300025700|Ga0209661_1237500 | Not Available | 511 | Open in IMG/M |
| 3300025701|Ga0209771_1029320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2211 | Open in IMG/M |
| 3300025704|Ga0209602_1146510 | Not Available | 764 | Open in IMG/M |
| 3300025712|Ga0209305_1194140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 598 | Open in IMG/M |
| 3300025751|Ga0208150_1026719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 2023 | Open in IMG/M |
| 3300025860|Ga0209119_1073246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1609 | Open in IMG/M |
| 3300025869|Ga0209308_10006012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 9157 | Open in IMG/M |
| 3300025881|Ga0209309_10002035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 19047 | Open in IMG/M |
| 3300025881|Ga0209309_10002076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 18815 | Open in IMG/M |
| 3300026426|Ga0247570_1043463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300026460|Ga0247604_1081500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300027612|Ga0209037_1140921 | Not Available | 584 | Open in IMG/M |
| 3300028672|Ga0257128_1019259 | Not Available | 1443 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 26.17% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 19.63% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.15% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 8.41% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.67% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.80% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.87% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.93% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.93% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.93% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023273 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG | Environmental | Open in IMG/M |
| 3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025700 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300026426 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028672 | Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100265192 | 3300000117 | Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHSAAPDSAMKKADF* |
| LP_A_09_P04_10DRAFT_10472382 | 3300000265 | Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGP |
| JGI20156J14371_100052122 | 3300001347 | Pelagic Marine | MPVSYQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| JGI20156J14371_101432382 | 3300001347 | Pelagic Marine | TLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| JGI20160J14292_100236384 | 3300001349 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPD |
| JGI20157J14317_101781681 | 3300001352 | Pelagic Marine | SGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAAPDSAMKKADS* |
| JGI20158J14315_101940791 | 3300001355 | Pelagic Marine | STLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| JGI26080J50196_10038094 | 3300003345 | Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| JGI26080J50196_10039321 | 3300003345 | Marine | SGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| JGI26084J50262_10026621 | 3300003427 | Marine | VSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| JGI26084J50262_10048938 | 3300003427 | Marine | VSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| JGI26273J51734_101961952 | 3300003620 | Marine | MPVSGXSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAES* |
| Ga0066605_100214795 | 3300004279 | Marine | RIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| Ga0066605_102073941 | 3300004279 | Marine | RIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| Ga0066605_102364751 | 3300004279 | Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMK |
| Ga0078893_103549352 | 3300005837 | Marine Surface Water | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAELDSAMKKADF* |
| Ga0075478_100052812 | 3300006026 | Aqueous | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDLAMKKADF* |
| Ga0075462_100110464 | 3300006027 | Aqueous | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAEPDSAMKKADF* |
| Ga0075511_10436532 | 3300006402 | Aqueous | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAVKKAES* |
| Ga0075486_18165552 | 3300006425 | Aqueous | TINGQFHQLSLLLGQLSYFTMPVSYQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| Ga0075461_100701431 | 3300006637 | Aqueous | STKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| Ga0075475_100136367 | 3300006874 | Aqueous | TLSTKYSMRLTNKHQNIEFLPIRARHGAKSDSAMKKAES* |
| Ga0075460_100416981 | 3300007234 | Aqueous | GQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| Ga0075460_101295811 | 3300007234 | Aqueous | STKYSMRLTNKHQNIEFLPIRARHSAAPDSAMKKADF* |
| Ga0102948_10000291 | 3300007623 | Water | TLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| Ga0105748_102185452 | 3300007992 | Estuary Water | MPASGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKVES* |
| Ga0115566_1000277918 | 3300009071 | Pelagic Marine | PVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| Ga0102885_10422002 | 3300009142 | Estuarine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAGPDSALKKADS* |
| Ga0114995_101692822 | 3300009172 | Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKLDSAMKKAES* |
| Ga0115551_14527061 | 3300009193 | Pelagic Marine | VPSQSTLSTKYSMRLTNKHQNIEFLPIRARHRAKRDSVMENADS* |
| Ga0115547_10761572 | 3300009426 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAAPDSAMKKADF* |
| Ga0115556_10100372 | 3300009437 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| Ga0115561_11209681 | 3300009440 | Pelagic Marine | LSLLLGQLSYFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| Ga0115563_12204622 | 3300009442 | Pelagic Marine | MPVPGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| Ga0115557_12113562 | 3300009443 | Pelagic Marine | CRIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS* |
| Ga0115553_13676592 | 3300009445 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAAPDSAMKKADS* |
| Ga0115565_100164576 | 3300009467 | Pelagic Marine | STKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADS* |
| Ga0115555_11935942 | 3300009476 | Pelagic Marine | MVSFISFLFFQGSCHIFTMPVSTQSTLYTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| Ga0115571_12598201 | 3300009495 | Pelagic Marine | YSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAES* |
| Ga0115568_101611792 | 3300009498 | Pelagic Marine | TMPVSYQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES* |
| Ga0115564_103515031 | 3300009505 | Pelagic Marine | IFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAAPDSAMKKADS* |
| Ga0115564_103917872 | 3300009505 | Pelagic Marine | QSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| Ga0115564_103979482 | 3300009505 | Pelagic Marine | QSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADS* |
| Ga0129342_13169952 | 3300010299 | Freshwater To Marine Saline Gradient | HQLSLLLGQLSYFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKSDSAMKKAES |
| Ga0129332_14849101 | 3300012969 | Aqueous | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHSAAPDSAMKK |
| Ga0129327_105627672 | 3300013010 | Freshwater To Marine Saline Gradient | CRIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF* |
| Ga0181565_103867312 | 3300017818 | Salt Marsh | MPASGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181565_108851482 | 3300017818 | Salt Marsh | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAKS |
| Ga0181552_101296332 | 3300017824 | Salt Marsh | SGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAKS |
| Ga0181584_100627152 | 3300017949 | Salt Marsh | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181607_102822892 | 3300017950 | Salt Marsh | FTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181607_105715661 | 3300017950 | Salt Marsh | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGA |
| Ga0181607_106512392 | 3300017950 | Salt Marsh | PVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0181583_102802321 | 3300017952 | Salt Marsh | STKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181571_104973692 | 3300017957 | Salt Marsh | MPASGQSTLSTKYSMKLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181582_105547942 | 3300017958 | Salt Marsh | MPASGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAADSAMKKAKS |
| Ga0181587_100723243 | 3300017968 | Salt Marsh | SGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181587_101750981 | 3300017968 | Salt Marsh | MPASGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKA |
| Ga0181600_101825142 | 3300018036 | Salt Marsh | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAGPDSALKKADS |
| Ga0181600_105387522 | 3300018036 | Salt Marsh | TKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAKS |
| Ga0181579_103031701 | 3300018039 | Salt Marsh | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKA |
| Ga0181558_100385316 | 3300018417 | Salt Marsh | MPVSGQSTLSTKYSMKLTNKHQNIEFLPIRARYGAAPDSAMKKAES |
| Ga0182058_13277621 | 3300019283 | Salt Marsh | IVTMPLNGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0194029_10074602 | 3300019751 | Freshwater | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES |
| Ga0194023_10088572 | 3300019756 | Freshwater | MPVSYQSTLSTKYSMRLTNKHQNIEFLPIRARHSAAPDSAMKKADF |
| Ga0194024_10114522 | 3300019765 | Freshwater | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHSAAPDSAMKKADF |
| Ga0181554_10574521 | 3300020052 | Salt Marsh | VSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAKS |
| Ga0206128_10689611 | 3300020166 | Seawater | GLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0181603_101601521 | 3300020174 | Salt Marsh | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAEPDSA |
| Ga0206124_100061192 | 3300020175 | Seawater | MPVSYQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES |
| Ga0211659_103518131 | 3300020404 | Marine | FFWGGCRIFTMPVSSQPTLSTKYSMRLTNKHQNIEFLPIRDQYGVKPDSALKKAGS |
| Ga0211577_100059864 | 3300020469 | Marine | MPVSGQSTLYTKYSMRLTNKHQNIEFLPIHARHGVKLDSAMKKAAS |
| Ga0206677_103101382 | 3300021085 | Seawater | MPVFGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAELDSAMKKADF |
| Ga0206682_103626952 | 3300021185 | Seawater | LLLGQLSYFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAELDSAMKKADF |
| Ga0210295_11852602 | 3300021323 | Estuarine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAES |
| Ga0222717_100911133 | 3300021957 | Estuarine Water | RIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0222716_100855352 | 3300021959 | Estuarine Water | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSAMKKADF |
| Ga0255771_10310386 | 3300022900 | Salt Marsh | LLLGQLSYFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARYGAAPDSAMKKAES |
| Ga0255756_10019401 | 3300022905 | Salt Marsh | VSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0255755_10769752 | 3300022909 | Salt Marsh | KYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAKS |
| Ga0255753_12889762 | 3300022926 | Salt Marsh | CRIFTMPASGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0255758_100324301 | 3300022928 | Salt Marsh | VSGQSTLSTKYSMRLTNKHQNIEFLPIRARYGAAPDSAMKKAES |
| Ga0255752_100369541 | 3300022929 | Salt Marsh | STLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKAKS |
| Ga0255766_103297491 | 3300023172 | Salt Marsh | TLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0255763_13477132 | 3300023273 | Salt Marsh | TLSTKYSMRLTNKHQNIEFLPIRARHGAAPDAAMKKADF |
| Ga0232123_10143192 | 3300023706 | Salt Marsh | GQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0228651_11037262 | 3300024293 | Seawater | MPVSGQSTLPTKYSMRLTNKHQNIEFLPIRARYGAAPDSATKKAES |
| (restricted) Ga0233443_13155652 | 3300024324 | Seawater | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKLMLSQ |
| Ga0228672_11503911 | 3300024335 | Seawater | SCRIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0209094_11103831 | 3300025594 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKA |
| Ga0208149_10814231 | 3300025610 | Aqueous | MPASGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDLAMKKADF |
| Ga0208004_11456782 | 3300025630 | Aqueous | YQSTLSTKYSMRLTNKHQNIEFLPIRARHGAKPDSSKKKAES |
| Ga0209136_10449882 | 3300025636 | Marine | IFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0208428_10203821 | 3300025653 | Aqueous | VSYQSTLSTKYSMRLTNKHQNIEFLPICARHGAKPDSSTKKAES |
| Ga0209661_12375002 | 3300025700 | Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0209771_10293204 | 3300025701 | Marine | GSCRIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0209602_11465102 | 3300025704 | Pelagic Marine | PVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0209305_11941402 | 3300025712 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADS |
| Ga0208150_10267191 | 3300025751 | Aqueous | YQSTLSTKYSMRLTNKHQNIEFLPICARHGAKPDSSTKKAES |
| Ga0209119_10732461 | 3300025860 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSA |
| Ga0209308_1000601212 | 3300025869 | Pelagic Marine | SGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0209309_100020358 | 3300025881 | Pelagic Marine | MPVSGQSTLSTKYSMRLTNKHQNIEFLPIRAQHGAAPDSAMKKADF |
| Ga0209309_1000207621 | 3300025881 | Pelagic Marine | CRIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAGPDSALKKADS |
| Ga0247570_10434631 | 3300026426 | Seawater | MPVSGQSTLPTKYSMRLTNKHQNIEFLPIRTRHGAGPD |
| Ga0247604_10815001 | 3300026460 | Seawater | MPVSGQSTLPTKYSMGLTNKHQNIEYLPIRARHGAEPDSAIKKVDF |
| Ga0209037_11409212 | 3300027612 | Marine | SCRIFTMPVSGQSTLSTKYSMRLTNKHQNIEFLPIRARHGAAPDSAMKKADF |
| Ga0257128_10192592 | 3300028672 | Marine | TKYSMRLTNKHQNIEFLPIHARHGAKPDSAMKKADS |
| ⦗Top⦘ |