


| Basic Information | |
|---|---|
| Family ID | F092083 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKNLILAAFAALSLTAAIMPIANAASTIAGDAQATRLQQTGSYSQ |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.38 % |
| % of genes near scaffold ends (potentially truncated) | 28.04 % |
| % of genes from short scaffolds (< 2000 bps) | 90.65 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.748 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere (14.019 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.383 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.187 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02515 | CoA_transf_3 | 4.67 |
| PF08734 | GYD | 3.74 |
| PF06071 | YchF-GTPase_C | 2.80 |
| PF00873 | ACR_tran | 1.87 |
| PF11937 | DUF3455 | 1.87 |
| PF02498 | Bro-N | 1.87 |
| PF13358 | DDE_3 | 1.87 |
| PF00072 | Response_reg | 0.93 |
| PF13635 | DUF4143 | 0.93 |
| PF01292 | Ni_hydr_CYTB | 0.93 |
| PF05717 | TnpB_IS66 | 0.93 |
| PF00118 | Cpn60_TCP1 | 0.93 |
| PF04966 | OprB | 0.93 |
| PF04226 | Transgly_assoc | 0.93 |
| PF00135 | COesterase | 0.93 |
| PF02826 | 2-Hacid_dh_C | 0.93 |
| PF00939 | Na_sulph_symp | 0.93 |
| PF00239 | Resolvase | 0.93 |
| PF04352 | ProQ | 0.93 |
| PF13444 | Acetyltransf_5 | 0.93 |
| PF01548 | DEDD_Tnp_IS110 | 0.93 |
| PF16694 | Cytochrome_P460 | 0.93 |
| PF00216 | Bac_DNA_binding | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 4.67 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 3.74 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 2.80 |
| COG3617 | Prophage antirepressor | Mobilome: prophages, transposons [X] | 1.87 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.93 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.93 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.93 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.93 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.93 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.93 |
| COG3109 | sRNA-binding protein ProQ | Signal transduction mechanisms [T] | 0.93 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.93 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.75 % |
| All Organisms | root | All Organisms | 39.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000313|WSSedB1CaDRAFT_10002652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6105 | Open in IMG/M |
| 3300002568|C688J35102_118277459 | Not Available | 544 | Open in IMG/M |
| 3300002568|C688J35102_118604220 | Not Available | 576 | Open in IMG/M |
| 3300002568|C688J35102_119422499 | Not Available | 692 | Open in IMG/M |
| 3300002568|C688J35102_120048192 | Not Available | 859 | Open in IMG/M |
| 3300002568|C688J35102_120505625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300002568|C688J35102_120758501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1501 | Open in IMG/M |
| 3300003163|Ga0006759J45824_1031615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 880 | Open in IMG/M |
| 3300003305|Ga0006770J48903_1004038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 715 | Open in IMG/M |
| 3300003544|Ga0007417J51691_1005274 | Not Available | 692 | Open in IMG/M |
| 3300003563|Ga0007430J51106_126705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 753 | Open in IMG/M |
| 3300003577|Ga0007416J51690_1004152 | Not Available | 639 | Open in IMG/M |
| 3300004081|Ga0063454_100356733 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005331|Ga0070670_101830076 | Not Available | 559 | Open in IMG/M |
| 3300005435|Ga0070714_101608131 | Not Available | 635 | Open in IMG/M |
| 3300005455|Ga0070663_101146766 | Not Available | 681 | Open in IMG/M |
| 3300005563|Ga0068855_101648248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 655 | Open in IMG/M |
| 3300005616|Ga0068852_101843931 | Not Available | 627 | Open in IMG/M |
| 3300005640|Ga0075035_1024302 | Not Available | 873 | Open in IMG/M |
| 3300005834|Ga0068851_11006190 | Not Available | 526 | Open in IMG/M |
| 3300006893|Ga0073928_10452610 | Not Available | 929 | Open in IMG/M |
| 3300006893|Ga0073928_10946223 | Not Available | 589 | Open in IMG/M |
| 3300006935|Ga0081246_1014215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1764 | Open in IMG/M |
| 3300009500|Ga0116229_10115697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 2392 | Open in IMG/M |
| 3300009500|Ga0116229_11483881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella oxytoca | 536 | Open in IMG/M |
| 3300009510|Ga0116230_10134425 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300009510|Ga0116230_11286401 | Not Available | 523 | Open in IMG/M |
| 3300009510|Ga0116230_11312772 | Not Available | 516 | Open in IMG/M |
| 3300009545|Ga0105237_12374496 | Not Available | 540 | Open in IMG/M |
| 3300009623|Ga0116133_1103570 | Not Available | 725 | Open in IMG/M |
| 3300009661|Ga0105858_1285972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300009701|Ga0116228_11191155 | Not Available | 502 | Open in IMG/M |
| 3300009787|Ga0116226_10477781 | Not Available | 1263 | Open in IMG/M |
| 3300010040|Ga0126308_10460323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300010045|Ga0126311_10181315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1523 | Open in IMG/M |
| 3300010045|Ga0126311_11274220 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300010855|Ga0126355_1089639 | Not Available | 514 | Open in IMG/M |
| 3300010857|Ga0126354_1057584 | Not Available | 779 | Open in IMG/M |
| 3300010864|Ga0126357_1291210 | Not Available | 530 | Open in IMG/M |
| 3300010864|Ga0126357_1316643 | Not Available | 532 | Open in IMG/M |
| 3300012212|Ga0150985_101493530 | Not Available | 693 | Open in IMG/M |
| 3300012212|Ga0150985_101712241 | Not Available | 713 | Open in IMG/M |
| 3300012212|Ga0150985_101967429 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300012212|Ga0150985_102134929 | Not Available | 595 | Open in IMG/M |
| 3300012212|Ga0150985_107444985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300012212|Ga0150985_108746816 | Not Available | 644 | Open in IMG/M |
| 3300012212|Ga0150985_111749198 | Not Available | 648 | Open in IMG/M |
| 3300012212|Ga0150985_115938820 | Not Available | 1533 | Open in IMG/M |
| 3300012212|Ga0150985_118606163 | Not Available | 1372 | Open in IMG/M |
| 3300012212|Ga0150985_119511981 | Not Available | 579 | Open in IMG/M |
| 3300012212|Ga0150985_119766379 | Not Available | 1571 | Open in IMG/M |
| 3300012212|Ga0150985_122580361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1422 | Open in IMG/M |
| 3300012410|Ga0134060_1314062 | Not Available | 542 | Open in IMG/M |
| 3300012469|Ga0150984_100854564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300012469|Ga0150984_103965495 | Not Available | 1039 | Open in IMG/M |
| 3300012469|Ga0150984_104090337 | Not Available | 1976 | Open in IMG/M |
| 3300012469|Ga0150984_104768995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 501 | Open in IMG/M |
| 3300012469|Ga0150984_108999437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 941 | Open in IMG/M |
| 3300012469|Ga0150984_109762742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 868 | Open in IMG/M |
| 3300012469|Ga0150984_109820493 | Not Available | 675 | Open in IMG/M |
| 3300012469|Ga0150984_115031029 | Not Available | 617 | Open in IMG/M |
| 3300012469|Ga0150984_120529364 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300012469|Ga0150984_121593377 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012924|Ga0137413_10481860 | Not Available | 909 | Open in IMG/M |
| 3300013307|Ga0157372_12335559 | Not Available | 614 | Open in IMG/M |
| 3300014497|Ga0182008_10377554 | Not Available | 757 | Open in IMG/M |
| 3300014497|Ga0182008_10612731 | Not Available | 612 | Open in IMG/M |
| 3300018033|Ga0187867_10589102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus necator | 609 | Open in IMG/M |
| 3300018468|Ga0066662_11625354 | Not Available | 674 | Open in IMG/M |
| 3300020081|Ga0206354_11332697 | Not Available | 635 | Open in IMG/M |
| 3300021151|Ga0179584_1104414 | Not Available | 505 | Open in IMG/M |
| 3300021170|Ga0210400_10839659 | Not Available | 752 | Open in IMG/M |
| 3300021170|Ga0210400_11261535 | Not Available | 593 | Open in IMG/M |
| 3300021404|Ga0210389_10423842 | Not Available | 1047 | Open in IMG/M |
| 3300021405|Ga0210387_10912045 | Not Available | 773 | Open in IMG/M |
| 3300021405|Ga0210387_10932334 | Not Available | 763 | Open in IMG/M |
| 3300022557|Ga0212123_10152737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1779 | Open in IMG/M |
| 3300022557|Ga0212123_10830686 | Not Available | 552 | Open in IMG/M |
| 3300022726|Ga0242654_10334171 | Not Available | 566 | Open in IMG/M |
| 3300025914|Ga0207671_10933966 | Not Available | 685 | Open in IMG/M |
| 3300027257|Ga0208996_1000023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7309 | Open in IMG/M |
| 3300027303|Ga0208999_1015467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1019 | Open in IMG/M |
| 3300027860|Ga0209611_10257353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1041 | Open in IMG/M |
| 3300028379|Ga0268266_11090171 | Not Available | 773 | Open in IMG/M |
| 3300028748|Ga0302156_10466142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 542 | Open in IMG/M |
| 3300028813|Ga0302157_10369592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 769 | Open in IMG/M |
| 3300028882|Ga0302154_10243481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 899 | Open in IMG/M |
| 3300029915|Ga0311358_11186146 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300029951|Ga0311371_11297224 | Not Available | 831 | Open in IMG/M |
| 3300029952|Ga0311346_11002685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 674 | Open in IMG/M |
| 3300029954|Ga0311331_11168193 | Not Available | 652 | Open in IMG/M |
| 3300030503|Ga0311370_10211668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2596 | Open in IMG/M |
| 3300030559|Ga0257205_1161864 | Not Available | 515 | Open in IMG/M |
| 3300030611|Ga0257182_1111944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300030860|Ga0074000_12644471 | Not Available | 562 | Open in IMG/M |
| 3300031124|Ga0308151_1007712 | Not Available | 939 | Open in IMG/M |
| 3300031236|Ga0302324_101588376 | Not Available | 844 | Open in IMG/M |
| 3300031788|Ga0302319_10256811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2109 | Open in IMG/M |
| 3300032074|Ga0308173_11048199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 759 | Open in IMG/M |
| 3300033475|Ga0310811_10061016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4996 | Open in IMG/M |
| 3300033475|Ga0310811_10925919 | Not Available | 781 | Open in IMG/M |
| 3300034268|Ga0372943_0232794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300034653|Ga0316599_067667 | Not Available | 918 | Open in IMG/M |
| 3300034653|Ga0316599_219416 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 14.02% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 6.54% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.54% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.74% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003563 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Bulk_46 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010855 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027303 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030559 | Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-LITTER (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030611 | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-1 (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030860 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034653 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| WSSedB1CaDRAFT_100026526 | 3300000313 | Wetland | MKNFVLAAFAALSLTAAIVPVANAASSVSNNPAATSMQQTGTLSR* |
| C688J35102_1182774591 | 3300002568 | Soil | MTMKNFILAAFAALSLTAAFVPAANARSTIGGDAQATRMQQTGTYGSGG* |
| C688J35102_1186042202 | 3300002568 | Soil | MKNLMLAAFAALSLTAAVVSAANAASTVTGDTQATRLQQSG |
| C688J35102_1194224991 | 3300002568 | Soil | MKNLMLAALAALSLTVAVVPAANAASTIAGDVQATRMQQTGAYGAGG* |
| C688J35102_1200481921 | 3300002568 | Soil | MKNLILAAFATLSLTAAIVPAANARSTIASDAQATRLQQTGAYGSGS* |
| C688J35102_1205056253 | 3300002568 | Soil | MKNLVLAAFAALSLITAVAPVANAASTIAGDAQATRMQQTGSY* |
| C688J35102_1207585011 | 3300002568 | Soil | ILSLTAAIVPAAIVPAANARSTIAGDAQATRLQQTGAYGAGG* |
| Ga0006759J45824_10316152 | 3300003163 | Avena Fatua Rhizosphere | MKNLLLAAFAALSLATAIVPVANARSTIASDAQATRLQQTGAYGSGG* |
| Ga0006770J48903_10040382 | 3300003305 | Avena Fatua Rhizosphere | PTGWMERPMKNLLLAAFAALSLATAIVPVANARSTIASDAQATRLQQTGAYGSGG* |
| Ga0007417J51691_10052742 | 3300003544 | Avena Fatua Rhizosphere | KNLLLAAFAALSLATAIVPVANARSTITSDAQATRLQQTGAYGSGG* |
| Ga0007430J51106_1267052 | 3300003563 | Avena Fatua Rhizosphere | PTGWMERPMKNLLLAAFAALSLATAIVPVANARSTITSDAQATRLQQTGAYGSGG* |
| Ga0007416J51690_10041524 | 3300003577 | Avena Fatua Rhizosphere | RPMKNLLLAAFAALSLATAIVPVANARSTITSDAQATRLQQTGAYGSGG* |
| Ga0063454_1003567331 | 3300004081 | Soil | PIGWMEIPMKNLILAAFATLSLTAAIVPAANARSTIASDAQATRLQQTGAYGSGS* |
| Ga0070670_1018300761 | 3300005331 | Switchgrass Rhizosphere | VLAAFAALSLITAVAPVANAASTIAGDAQATRMQQTGSY* |
| Ga0070714_1016081312 | 3300005435 | Agricultural Soil | MKNLVLAAFAALSLITAVAPVANAASTIAGDAQATRIQQTGSY* |
| Ga0070663_1011467661 | 3300005455 | Corn Rhizosphere | NPMKNFILAAFAALSLTAAVVPVANAHSTVAGDAQATRMQQTGSY* |
| Ga0068855_1016482482 | 3300005563 | Corn Rhizosphere | MKNLILAAFAALSLTAAIAPIASASTVADDAQATRFQQTGTLR* |
| Ga0068852_1018439311 | 3300005616 | Corn Rhizosphere | MKNLVLAAFAALSLITAVAPVANAASTIAGDAQATRMQQTGSL* |
| Ga0075035_10243022 | 3300005640 | Permafrost Soil | RWRIPMKNLILVAIAALSLTAAIVPAANANSTIAGDSQATRQQQTGSYSE* |
| Ga0068851_110061902 | 3300005834 | Corn Rhizosphere | MKNFILAAFAALSLTAAVVPVANAHSTVAGDAQATRMQQTGSY* |
| Ga0075037_18912321 | 3300006426 | Permafrost Soil | IAALSLTAAIVPAANANSTIAGDSQATRQQQTGSYSE* |
| Ga0073928_104526103 | 3300006893 | Iron-Sulfur Acid Spring | MKNLILAAFAALSLTAAIMPIANAASTIAGDAQATRLQQTGSYSQ* |
| Ga0073928_109462231 | 3300006893 | Iron-Sulfur Acid Spring | MKNLILAAFAALSLTAAITPIANAASTIAGDAQATRLQQTGSYSQ* |
| Ga0081246_10142151 | 3300006935 | Tropical Rainforest Soil | MKNFVLAAFAALSLTTAIASVASAHSTIAGDVRATQMQ |
| Ga0105245_113336092 | 3300009098 | Miscanthus Rhizosphere | FAALSLTAAVVPVANAHSTVAGDAQATRMQQTGSY* |
| Ga0116229_101156974 | 3300009500 | Host-Associated | MKNLILAAFAALSLGVGVANAAVVGDHSTVAGDRSATLMQQTGSYGAE* |
| Ga0116229_114838812 | 3300009500 | Host-Associated | MKNLILATVAILGLTATVIPAANAASTIAGDAAATRSQQLSGSFGN* |
| Ga0116230_101344253 | 3300009510 | Host-Associated | MKNLILAAFAALSLGAAVVPAYAASTIAGDAQATRMQQTGSYSQ* |
| Ga0116230_112864012 | 3300009510 | Host-Associated | RIPMKNLMLAAFAALSLGAAVVPAYAASTIAGDAQATRMQQTGVYAE* |
| Ga0116230_113127721 | 3300009510 | Host-Associated | MKNLILAAFAALSLGAAVVPAYAATIAGDAQATRMQQTGSYGGE* |
| Ga0105237_123744962 | 3300009545 | Corn Rhizosphere | MKNLVLAAFAALSLIPAVAPVANAASTIAGDAQATRMQQTGSY* |
| Ga0116133_11035702 | 3300009623 | Peatland | MKNLILAAFAALSLTAAIAPFAHAASTITGDGKATRMQQTGSYGGGGS* |
| Ga0105858_12859721 | 3300009661 | Permafrost Soil | MKNLILAAIAALSLGVGVANAASTVVGDAQATRNKQTGSYSE* |
| Ga0116228_111911552 | 3300009701 | Host-Associated | MKNLILAAFAALSLGAPVVPAYAASTVAGDAQATRMQQTGSYSE* |
| Ga0116226_104777813 | 3300009787 | Host-Associated | MKNLILAAFAALSLGAAVVPAYAASTIAGDAQATRMQQTGSYTE* |
| Ga0126308_104603232 | 3300010040 | Serpentine Soil | MEISMKNLILAAFTVLSLTAAIAPVASAASTVAGDSTATRMQQTGSYGGA* |
| Ga0126311_101813152 | 3300010045 | Serpentine Soil | MEISMKNLILAAFTVLSLTAAIAPVASAASTVAGDSTATRMQQTGSYGR* |
| Ga0126311_112742202 | 3300010045 | Serpentine Soil | MKNLILAAFAALSLTAAIAPVASADSTIAGNAQATRLQQTGSLSQ* |
| Ga0126355_10896391 | 3300010855 | Boreal Forest Soil | MKNLILAAFAALSLSAAVVPAAFAHSTVADDAGATRFQQLNSYSQ* |
| Ga0126354_10575841 | 3300010857 | Boreal Forest Soil | IPPGVRGRIPMKNLILAAFAALSLTTAIVPAAFAASTVAGDAQATRQQQTGSYSE* |
| Ga0126357_12912102 | 3300010864 | Boreal Forest Soil | MKNLILAAIAALSLGVGVANAASTVAGDAQATRNQQTGSYSE* |
| Ga0126357_13166431 | 3300010864 | Boreal Forest Soil | MKNLILAAFAALSLSTAIVPAAFARSTIAGDALATQMQQQGQL* |
| Ga0150985_1014935301 | 3300012212 | Avena Fatua Rhizosphere | SRPTGWMERPMKNLLLAAFAALSLATAIVPVANARSTIAGDAQATRLQQTGAYGSGG* |
| Ga0150985_1017122411 | 3300012212 | Avena Fatua Rhizosphere | MEIPMKNLILAAFAVLSLTAAIVPAANARSTIAGDAQATRLQQTGAYGSGG* |
| Ga0150985_1019674293 | 3300012212 | Avena Fatua Rhizosphere | VTMKNLLLGAIAALSLSVISPVANAASTIAGDTQATQMQQTGSYGQ* |
| Ga0150985_1021349291 | 3300012212 | Avena Fatua Rhizosphere | MEDHPMKSFILAAFAVLSLTAAVVSAASAAGTVAGDEQATRMQQTGAYSQ* |
| Ga0150985_1074449851 | 3300012212 | Avena Fatua Rhizosphere | MKNLLLAAFAALSLATAIVPVANARSTIASDAQATR |
| Ga0150985_1087468162 | 3300012212 | Avena Fatua Rhizosphere | MKNLLLAAFAALSLTAAIVPVVNARSTIASNAQATRLQQTGAYGSAG* |
| Ga0150985_1117491981 | 3300012212 | Avena Fatua Rhizosphere | MKNLLLAAIAALSFSVIGPEANAASTIASDTQATRLQQSGVYSSGG* |
| Ga0150985_1159388203 | 3300012212 | Avena Fatua Rhizosphere | MKNLILAAFTALSLTAAVVPVANAHSTIAGDAQATQMQQTGAYSG* |
| Ga0150985_1186061633 | 3300012212 | Avena Fatua Rhizosphere | MKNLLLAAITALSLSVIAPVANAASTITGDTQATQMQQTGSYGQ* |
| Ga0150985_1195119811 | 3300012212 | Avena Fatua Rhizosphere | MKNLVLAAFAALSLTAAIAPVASADSTIAEDAQATRMQQTGSYGV* |
| Ga0150985_1197663792 | 3300012212 | Avena Fatua Rhizosphere | MEDHSMKNLILAAFAALSLTAAIVPAANAHSTIGGDTQATRLQQTGALSG* |
| Ga0150985_1225803612 | 3300012212 | Avena Fatua Rhizosphere | MEDHSMKNLMLAALAALSLTAAIVPAVNARSTVGGDTQATRMQQTGAYGSGG* |
| Ga0134060_13140621 | 3300012410 | Grasslands Soil | RTSRPTGWMEIPMKNLILAAFAALSLTAAIVPVANARSTIAGDAQATRLQQTGAYGSGG* |
| Ga0150984_1008545641 | 3300012469 | Avena Fatua Rhizosphere | SHPTGDGDHSMKNLILAVFAALSLTAAVVPVANARSSVTGDAQATRMQQTGAYSG* |
| Ga0150984_1039654952 | 3300012469 | Avena Fatua Rhizosphere | MEIPMKNLLLAAFAALSLTAAIVPAANARSTVGGDTQATRMQQTGAYGSGG* |
| Ga0150984_1040903371 | 3300012469 | Avena Fatua Rhizosphere | GGFTMKNLLLAAITALSLSVIAPVANAASTITGDTQATQMQQTGSYGQ* |
| Ga0150984_1047689952 | 3300012469 | Avena Fatua Rhizosphere | MEDHSMKNLMLAALAALSLTVAVVPAANAASTIAGDVQATRMQQTGAYGAGG* |
| Ga0150984_1089994373 | 3300012469 | Avena Fatua Rhizosphere | RPTGWMEISMKNLILAAFAILSLTAAIVPAANARSTIAGDAQATRLQQTGAYGAGG* |
| Ga0150984_1097627422 | 3300012469 | Avena Fatua Rhizosphere | MKNLVLAAFAALSLTAAIAPVALANSTIAQDAQATRMQQTGSYSR* |
| Ga0150984_1098204931 | 3300012469 | Avena Fatua Rhizosphere | MEDHSMKNLMLAVLAALSLTATVVPAANAYSTVAGDAQATQMQQTGAYSG* |
| Ga0150984_1150310291 | 3300012469 | Avena Fatua Rhizosphere | MKNLLLAAFAALSLATAIVPVANARSTIAGDAQATRLQQTGAYGSGG* |
| Ga0150984_1205293642 | 3300012469 | Avena Fatua Rhizosphere | VTMKNLLLGAIAALSLSVIAPVANAASTIAGDTQATQMQQTGSYGQ* |
| Ga0150984_1215933772 | 3300012469 | Avena Fatua Rhizosphere | MEDHSMKNLMLAAFAALSLTPAVVSAANAASTVTGDTQATRLQQSGAYGAGG* |
| Ga0137413_104818601 | 3300012924 | Vadose Zone Soil | MGEFQMKNLILAAIAALSLGVGVANAASTVAGDAQATRNQQTGSYSE* |
| Ga0157372_123355592 | 3300013307 | Corn Rhizosphere | FILAAFAALSLTAAVVPVANAHSTVAGDAQATRMQQTGSY* |
| Ga0182008_103775542 | 3300014497 | Rhizosphere | KNLLLAAFAALSLTAAIVPVANARSTIAGDAQATRLQQTGAYGSGG* |
| Ga0182008_106127311 | 3300014497 | Rhizosphere | MEDHSMKNLILAAFAALSLTAAVVPAANAHSTIAGDAQATRMQQTGAYSG* |
| Ga0187867_105891022 | 3300018033 | Peatland | MKNLILAAFAALSLTAAIAPFAHAASTITGDGKATRMQQTGSYGGGGS |
| Ga0066662_110023071 | 3300018468 | Grasslands Soil | LSLTAAIVPVANARSTIAGDAQATRLQQTGAYGSGG |
| Ga0066662_116253541 | 3300018468 | Grasslands Soil | MKNLILAAFAALSLTAAIAPVANAGSTIAGDAQATRMQQ |
| Ga0206354_113326972 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | SCPANNGDSPMRHFILAAFAALSLTAAIAPVAQAASTVAGDQQATRMQQTGSYSQ |
| Ga0179584_11044142 | 3300021151 | Vadose Zone Soil | MRNMILAAIAALSLTAAIVPAANANSTIAGNAQATRQQQTGSYSE |
| Ga0210400_108396591 | 3300021170 | Soil | MKTKALVLAAVAVMSLTAAIIPIANAASTIAGDAKATRMQQTGSYSGGGG |
| Ga0210400_112615351 | 3300021170 | Soil | GRPLGDLKMKNLVLAAFAVLSLTAAIAPVAKAASTIAGDAQATRMQQTGAYGGQ |
| Ga0210389_104238421 | 3300021404 | Soil | MKTKALVLAAVAVMSLTAAIIPIANAASTIAGDAKATRMQQTGGYSGGGG |
| Ga0210387_109120451 | 3300021405 | Soil | MKTKVLVLAAVTVMSLTAAIVPIAHAASTIAGDAKATRMQQTGSYSGGGG |
| Ga0210387_109323342 | 3300021405 | Soil | MKTKALVLAAVAVMSLTAAIVPIANAASTISGDAAATRMQQTGSYGGGGG |
| Ga0212123_101527372 | 3300022557 | Iron-Sulfur Acid Spring | MKNLILAAFAALSLTAAITPIANAASTIAGDAQATRLQQTGSYSQ |
| Ga0212123_108306861 | 3300022557 | Iron-Sulfur Acid Spring | MKNLILAAFAALSLTAAIMPIANAASTIAGDAQATRLQQTGSYSQ |
| Ga0242654_103341712 | 3300022726 | Soil | MKNLILAAIAALSLTTAIVPAAFARSTVAGDSAATRMQQTGSYSQ |
| Ga0207671_109339662 | 3300025914 | Corn Rhizosphere | MKNFILAAFAALSLTAAVVPVANAHSTVAGDAQATRMQQTGSY |
| Ga0208996_10000236 | 3300027257 | Forest Soil | MKNMILAAVAALGLATAFVPVAANASTVAGDAQATRVQQTGSYS |
| Ga0208999_10154671 | 3300027303 | Forest Soil | MENFSMKNMILAAVAALGLATAFVPVAANASTVAGDAQATRVQQTGSYS |
| Ga0209611_102573532 | 3300027860 | Host-Associated | MKNLILAAFAALSLGVGVANAAVVGDHSTVAGDRSATLMQQTGSYGAE |
| Ga0268266_110901712 | 3300028379 | Switchgrass Rhizosphere | MKNLFLAALAALSLSAAVVPAFAQSTVRGDATATRLQQTQQYGTDGGN |
| Ga0302156_104661421 | 3300028748 | Bog | MKNLILAAFAALSLGAAVVPAYAASTIAGDAQATRMQQTGSYRQ |
| Ga0302157_103695922 | 3300028813 | Bog | MKNLILAAFAALSLTAAIAPFAHAASTVTGDGKATRMQQTGSYGGAGS |
| Ga0302154_102434812 | 3300028882 | Bog | MKNLILAAFAALSLTAAIAPFAHAASTVTGDGKATRMQQTGSYG |
| Ga0311358_111861462 | 3300029915 | Bog | MKNLILAAFAALSLTAAIAPFAHAASTVTGDGKATRMQQTGSYGGA |
| Ga0311371_112972241 | 3300029951 | Palsa | MKNLILAAFAVLSLSAAVVPAYAASSVVGDAAATRMQQTGGYSL |
| Ga0311346_110026852 | 3300029952 | Bog | MKNLILAAFAALSLGAAVVPAYAASTIAGDAQATRMQQTGSYSE |
| Ga0311331_111681932 | 3300029954 | Bog | MKNLILAAFAAICLTAAIAPVVNAASATSGDRPATRMQQTGSYGQ |
| Ga0311370_102116682 | 3300030503 | Palsa | MKNLILAAFAALSLSAVVVPVANAATRMQQTGSYGGE |
| Ga0257205_11618641 | 3300030559 | Host-Associated | MKTMILAAFAALSLGAAFVPAFAASTVADDASATRMQQTGVYSR |
| Ga0257182_11119441 | 3300030611 | Host-Associated | MKNLILAAFAALSFGASVVPAYAASMIAGDAQATRLQQTSPNAAQ |
| Ga0074000_126444713 | 3300030860 | Soil | MKTMILAAFAALSLGAAVVPAYATSTIAGDAQATR |
| Ga0308151_10077122 | 3300031124 | Soil | MKNLILAAFAALSLTAAVVPVANATSTVADDAQATSMQQTGAYGSGG |
| Ga0302324_1015883761 | 3300031236 | Palsa | MKNLILAAFAVLSLGAAVVPAYAASSVVGDAAATRMQQTGGYSL |
| Ga0302319_102568111 | 3300031788 | Bog | MKNLILAAFAAIGLTAAIAPVVNAASATSGDRPATRMQQTGSYGQ |
| Ga0308173_110481992 | 3300032074 | Soil | MKNLLLAAFAALSLTAAIVPVANARSTIASDAQATRLQQTGAYGSG |
| Ga0310811_100610165 | 3300033475 | Soil | MKTKILVLAAVAIMSLTAAIVPIANAASTIAGDAKATRMQQAGSYSGGGG |
| Ga0310811_109259192 | 3300033475 | Soil | MKNLVLAAFAVLSLTAAIAPVAKAASTIAGDAQATRMQQTGAYGGQ |
| Ga0372943_0232794_860_1009 | 3300034268 | Soil | MENFSMKNMILAAVAALGLATAFVPVAANASTVAGDAQATPVQQTGSYS |
| Ga0316599_067667_27_164 | 3300034653 | Untreated Peat Soil | MKNLILAAFAALSLITAVAPVANAASTIAGDAQATRMQQTGSYGL |
| Ga0316599_219416_342_494 | 3300034653 | Untreated Peat Soil | MGDIPMKNLVLAAFAALSLITAVAPVANAASTVAGDAQATRLQQTGSYGL |
| ⦗Top⦘ |