


| Basic Information | |
|---|---|
| Family ID | F092043 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MMPWYKKLLYILIAPFIIGAWCIMNPRKVWEQAKKDFGVE |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 92.52 % |
| % of genes near scaffold ends (potentially truncated) | 13.08 % |
| % of genes from short scaffolds (< 2000 bps) | 73.83 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (45.794 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (33.645 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.551 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.439 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07486 | Hydrolase_2 | 2.80 |
| PF14743 | DNA_ligase_OB_2 | 2.80 |
| PF04055 | Radical_SAM | 1.87 |
| PF16473 | Rv2179c-like | 1.87 |
| PF00596 | Aldolase_II | 1.87 |
| PF10902 | WYL_2 | 1.87 |
| PF04488 | Gly_transf_sug | 1.87 |
| PF07068 | Gp23 | 1.87 |
| PF08406 | CbbQ_C | 1.87 |
| PF02562 | PhoH | 0.93 |
| PF00497 | SBP_bac_3 | 0.93 |
| PF07460 | NUMOD3 | 0.93 |
| PF04434 | SWIM | 0.93 |
| PF03232 | COQ7 | 0.93 |
| PF09374 | PG_binding_3 | 0.93 |
| PF14279 | HNH_5 | 0.93 |
| PF03567 | Sulfotransfer_2 | 0.93 |
| PF01467 | CTP_transf_like | 0.93 |
| PF00004 | AAA | 0.93 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.93 |
| PF00574 | CLP_protease | 0.93 |
| PF11927 | DUF3445 | 0.93 |
| PF12850 | Metallophos_2 | 0.93 |
| PF01068 | DNA_ligase_A_M | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 2.80 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.87 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 1.87 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.87 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.93 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.93 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.93 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.93 |
| COG2941 | Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis) | Coenzyme transport and metabolism [H] | 0.93 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.93 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.93 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.42 % |
| Unclassified | root | N/A | 33.64 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002161|JGI24766J26685_10039175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300002161|JGI24766J26685_10069253 | Not Available | 770 | Open in IMG/M |
| 3300002835|B570J40625_100019572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11529 | Open in IMG/M |
| 3300002835|B570J40625_100485409 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300002835|B570J40625_101055072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300003277|JGI25908J49247_10051339 | Not Available | 1077 | Open in IMG/M |
| 3300004685|Ga0065177_1036586 | Not Available | 926 | Open in IMG/M |
| 3300005580|Ga0049083_10221847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300005581|Ga0049081_10001540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8690 | Open in IMG/M |
| 3300005581|Ga0049081_10287134 | Not Available | 569 | Open in IMG/M |
| 3300005582|Ga0049080_10004985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4609 | Open in IMG/M |
| 3300005582|Ga0049080_10225625 | Not Available | 615 | Open in IMG/M |
| 3300005662|Ga0078894_10004630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10542 | Open in IMG/M |
| 3300005662|Ga0078894_10991383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300005805|Ga0079957_1021369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4501 | Open in IMG/M |
| 3300006030|Ga0075470_10220931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300006101|Ga0007810_1110359 | Not Available | 524 | Open in IMG/M |
| 3300006484|Ga0070744_10063889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
| 3300007169|Ga0102976_1008386 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300007212|Ga0103958_1004212 | All Organisms → Viruses → Predicted Viral | 4949 | Open in IMG/M |
| 3300007214|Ga0103959_1173404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
| 3300007216|Ga0103961_1325458 | All Organisms → Viruses | 1248 | Open in IMG/M |
| 3300008110|Ga0114343_1158192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300008113|Ga0114346_1108156 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300008113|Ga0114346_1247560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300009151|Ga0114962_10000443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36759 | Open in IMG/M |
| 3300009151|Ga0114962_10035087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3410 | Open in IMG/M |
| 3300009152|Ga0114980_10341003 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 865 | Open in IMG/M |
| 3300009155|Ga0114968_10009226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7160 | Open in IMG/M |
| 3300009155|Ga0114968_10692928 | Not Available | 534 | Open in IMG/M |
| 3300009158|Ga0114977_10110806 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300009159|Ga0114978_10140379 | Not Available | 1563 | Open in IMG/M |
| 3300009159|Ga0114978_10331526 | Not Available | 925 | Open in IMG/M |
| 3300009159|Ga0114978_10719906 | Not Available | 568 | Open in IMG/M |
| 3300009159|Ga0114978_10753143 | Not Available | 552 | Open in IMG/M |
| 3300009161|Ga0114966_10026025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4367 | Open in IMG/M |
| 3300009161|Ga0114966_10055284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2800 | Open in IMG/M |
| 3300009161|Ga0114966_10294162 | Not Available | 985 | Open in IMG/M |
| 3300009164|Ga0114975_10300392 | Not Available | 889 | Open in IMG/M |
| 3300009172|Ga0114995_10081542 | Not Available | 1820 | Open in IMG/M |
| 3300009181|Ga0114969_10153720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1443 | Open in IMG/M |
| 3300009184|Ga0114976_10590623 | Not Available | 564 | Open in IMG/M |
| 3300009502|Ga0114951_10362360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300009684|Ga0114958_10229685 | Not Available | 921 | Open in IMG/M |
| 3300010160|Ga0114967_10342048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300010334|Ga0136644_10692232 | Not Available | 554 | Open in IMG/M |
| 3300010354|Ga0129333_10020224 | Not Available | 6327 | Open in IMG/M |
| 3300010354|Ga0129333_10477335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
| 3300010354|Ga0129333_11284099 | Not Available | 605 | Open in IMG/M |
| 3300010354|Ga0129333_11664539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300010370|Ga0129336_10500184 | Not Available | 655 | Open in IMG/M |
| 3300010885|Ga0133913_10249336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4715 | Open in IMG/M |
| 3300010885|Ga0133913_10256085 | Not Available | 4646 | Open in IMG/M |
| 3300010885|Ga0133913_10260631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4602 | Open in IMG/M |
| 3300010885|Ga0133913_11658321 | All Organisms → Viruses → Predicted Viral | 1610 | Open in IMG/M |
| 3300010885|Ga0133913_11893819 | unclassified Hyphomonas → Hyphomonas sp. | 1487 | Open in IMG/M |
| 3300011995|Ga0153800_1017352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300012017|Ga0153801_1011312 | All Organisms → Viruses → Predicted Viral | 1619 | Open in IMG/M |
| 3300012665|Ga0157210_1032329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300013285|Ga0136642_1066694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300013285|Ga0136642_1092595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300013372|Ga0177922_10135900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group | 804 | Open in IMG/M |
| 3300013372|Ga0177922_10539986 | Not Available | 702 | Open in IMG/M |
| 3300017754|Ga0181344_1064976 | Not Available | 1078 | Open in IMG/M |
| 3300017754|Ga0181344_1153814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 2KL-3 | 656 | Open in IMG/M |
| 3300017761|Ga0181356_1158997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctrgt10 | 695 | Open in IMG/M |
| 3300017777|Ga0181357_1330423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300017778|Ga0181349_1072794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
| 3300020141|Ga0211732_1598453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604 | 1324 | Open in IMG/M |
| 3300020161|Ga0211726_10428430 | Not Available | 569 | Open in IMG/M |
| 3300020161|Ga0211726_10669910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300020162|Ga0211735_11474635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604 | 884 | Open in IMG/M |
| 3300021131|Ga0214206_1004213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2604 | Open in IMG/M |
| 3300022179|Ga0181353_1041537 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300022179|Ga0181353_1048940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300022179|Ga0181353_1079902 | Not Available | 827 | Open in IMG/M |
| 3300022555|Ga0212088_10352158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300022752|Ga0214917_10013762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7180 | Open in IMG/M |
| 3300024346|Ga0244775_10128197 | Not Available | 2148 | Open in IMG/M |
| 3300024346|Ga0244775_10740912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300027608|Ga0208974_1000338 | Not Available | 20470 | Open in IMG/M |
| 3300027697|Ga0209033_1004547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6964 | Open in IMG/M |
| 3300027708|Ga0209188_1229073 | Not Available | 653 | Open in IMG/M |
| 3300027712|Ga0209499_1089858 | Not Available | 1181 | Open in IMG/M |
| 3300027733|Ga0209297_1359916 | Not Available | 525 | Open in IMG/M |
| 3300027741|Ga0209085_1000286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37927 | Open in IMG/M |
| 3300027752|Ga0209192_10133547 | Not Available | 994 | Open in IMG/M |
| 3300027754|Ga0209596_1000019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 165347 | Open in IMG/M |
| 3300027754|Ga0209596_1094802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
| 3300027759|Ga0209296_1011358 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 5331 | Open in IMG/M |
| 3300027759|Ga0209296_1115286 | Not Available | 1259 | Open in IMG/M |
| 3300027782|Ga0209500_10045206 | Not Available | 2386 | Open in IMG/M |
| 3300027782|Ga0209500_10234939 | Not Available | 808 | Open in IMG/M |
| 3300027797|Ga0209107_10133064 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300027797|Ga0209107_10243357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300027805|Ga0209229_10140312 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300027805|Ga0209229_10180708 | Not Available | 946 | Open in IMG/M |
| 3300027805|Ga0209229_10340209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300027963|Ga0209400_1021921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3731 | Open in IMG/M |
| 3300028394|Ga0304730_1203328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300031784|Ga0315899_11162444 | Not Available | 672 | Open in IMG/M |
| 3300031857|Ga0315909_10889667 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 551 | Open in IMG/M |
| 3300033816|Ga0334980_0020249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 2859 | Open in IMG/M |
| 3300033978|Ga0334977_0001049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16082 | Open in IMG/M |
| 3300034063|Ga0335000_0200432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
| 3300034106|Ga0335036_0003714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13128 | Open in IMG/M |
| 3300034106|Ga0335036_0142221 | All Organisms → Viruses → Predicted Viral | 1716 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 33.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.28% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 4.67% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.74% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.80% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.87% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.87% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.93% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24766J26685_100391753 | 3300002161 | Freshwater And Sediment | MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVEE* |
| JGI24766J26685_100692534 | 3300002161 | Freshwater And Sediment | NDIAPHMELKMIPWYRRLLYILVAPFIIGAWCIMNPRKVWEQAKKDFGVE* |
| B570J40625_10001957239 | 3300002835 | Freshwater | MMPWYKKLLYILIAPFIIGAWCIMNPRKVWEQAKKDFGVE* |
| B570J40625_1004854093 | 3300002835 | Freshwater | MPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGVE* |
| B570J40625_1010550722 | 3300002835 | Freshwater | MIMPWYKKLLYILIAPFIIGAWCIVNPRKVWEQAKKDFGVE* |
| JGI25908J49247_100513395 | 3300003277 | Freshwater Lake | MISGYKKLVYIFIAPFVIGAWCVMNPRKVWEQAKKDFGVEL* |
| Ga0065177_10365861 | 3300004685 | Freshwater | MIPKYKIVLYILIAPFVIGAWCIMNPRKVWEQAKKDFGVEE* |
| Ga0049083_102218472 | 3300005580 | Freshwater Lentic | MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEL* |
| Ga0049081_1000154010 | 3300005581 | Freshwater Lentic | MPWYKKLLYILIAPFIIGVWCIMNPRTVWEQAKKDFGFEK* |
| Ga0049081_102871342 | 3300005581 | Freshwater Lentic | MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVKE* |
| Ga0049080_1000498511 | 3300005582 | Freshwater Lentic | MMPWYKKLLYILIAPFIIGVWCIMNPRTVWEQAKKDFGFEK* |
| Ga0049080_102256251 | 3300005582 | Freshwater Lentic | MMPWYKKLLYILLAPFIIGAWCIMNPGKVWEQAKKDFGVEE* |
| Ga0078894_100046309 | 3300005662 | Freshwater Lake | MMPWHKKLLLIIIAPFVIGAWCIMNPRRVWEQAKKDFGVEL* |
| Ga0078894_109913833 | 3300005662 | Freshwater Lake | MMPWYKKIGYLAIAPFIIGAWCVINPKKVWEQAKKDLLRK* |
| Ga0079957_10213695 | 3300005805 | Lake | MIPWYRKLVYVLIAPFIIVLWCIMNPGKVWEQAKKDFGVE* |
| Ga0075470_102209312 | 3300006030 | Aqueous | MIPWYRKLVYIVIAPFIIGAWCIMNPRRVWEQAKKDFGVEE* |
| Ga0007810_11103593 | 3300006101 | Freshwater | MMPWYKKLLYIIIAPFIIGAWCLMNPRKVWEQAKKDFGVE* |
| Ga0070744_100638893 | 3300006484 | Estuarine | MPWYKKLLLIIIAPFVIGAWCIMNPRRVWEQAKKDFGVEL* |
| Ga0102976_10083863 | 3300007169 | Freshwater Lake | MNIPWYRKVLYLFIAPFIILAFCILNPRKVYEQAKKDFGVE* |
| Ga0103958_10042123 | 3300007212 | Freshwater Lake | MNIPWYRKVLYFFIAPFIILAFCILNPRKVYEQAKKDFGVE* |
| Ga0103959_11734045 | 3300007214 | Freshwater Lake | MNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFG |
| Ga0103961_13254584 | 3300007216 | Freshwater Lake | MNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFGVE* |
| Ga0114343_11581921 | 3300008110 | Freshwater, Plankton | MTPWYKKLLLIIIAPVVIGAWCIMNPRKVWEQAKKDFGVKE* |
| Ga0114346_11081563 | 3300008113 | Freshwater, Plankton | MIMPWYKKLLLIIIAPFVIGAWCIMNPWKLWEQAKKDFGVKE* |
| Ga0114346_12475602 | 3300008113 | Freshwater, Plankton | MMPWYKKIGYLAIAPFIIGAWCVMNPKKVWEQAKKDLLRK* |
| Ga0114962_1000044342 | 3300009151 | Freshwater Lake | MIPWYKKLLLMIIAPFIIGAWCVMNPRKVWVQAKKDFGVKE* |
| Ga0114962_100350875 | 3300009151 | Freshwater Lake | MIPWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE* |
| Ga0114980_103410031 | 3300009152 | Freshwater Lake | MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE* |
| Ga0114968_1000922611 | 3300009155 | Freshwater Lake | MPWYKKLLLLLIAPFIIGAWCVMNPRRVWEQAKKDFGVE* |
| Ga0114968_106929282 | 3300009155 | Freshwater Lake | MMPWYKKLFLMIIAPFIIGAWCIMNPRKVWAQAKKDFGVEE* |
| Ga0114977_101108063 | 3300009158 | Freshwater Lake | MMPWYKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE* |
| Ga0114978_101403792 | 3300009159 | Freshwater Lake | MMTWYKKLLFMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEEN* |
| Ga0114978_103315262 | 3300009159 | Freshwater Lake | MSWYKKLLLIIIAPFVIGAWCIMNPRKVWEQAKKDFGVTE* |
| Ga0114978_107199062 | 3300009159 | Freshwater Lake | MLPLYRKVLLIIVAPFIIGAWCIMNPRKVWEQAKKDYKL* |
| Ga0114978_107531431 | 3300009159 | Freshwater Lake | MPWHKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE* |
| Ga0114966_100260253 | 3300009161 | Freshwater Lake | MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKHFGDKE* |
| Ga0114966_100552844 | 3300009161 | Freshwater Lake | MMPWYKKLFLMIIAPFIIGAWCIMNPRKVWAQAKKDFGVK* |
| Ga0114966_102941624 | 3300009161 | Freshwater Lake | MMPWYKKLFLMIIAPFIIGAWCIMNPRRVWDQAKKDFGVKE* |
| Ga0114975_103003922 | 3300009164 | Freshwater Lake | MTPWYKKLVYILLAPFVIGAWCVMNPRKVWEQAKKDFGVE* |
| Ga0114995_100815426 | 3300009172 | Marine | MIPWYNKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE* |
| Ga0114969_101537205 | 3300009181 | Freshwater Lake | MMPWYKKLLLIIIAPFIIGAWCIMNPSKVWKQAKKDFGVEE* |
| Ga0114976_105906232 | 3300009184 | Freshwater Lake | MMTWYKKLLFMIIAPFIIGAWCIMNPRKVWEQAKKDFGVTE* |
| Ga0114951_103623604 | 3300009502 | Freshwater | MMPWYKKLLLLLIAPFVIGAWCIMNPRRVWEQAKK |
| Ga0114958_102296854 | 3300009684 | Freshwater Lake | MIPWYKRLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE* |
| Ga0114967_103420481 | 3300010160 | Freshwater Lake | RMMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE* |
| Ga0136644_106922322 | 3300010334 | Freshwater Lake | MIRKYRIILYILIAPFIIGAWCVMNPRKVWEQAKKDFGVEE* |
| Ga0129333_1002022413 | 3300010354 | Freshwater To Marine Saline Gradient | MIPWYKKLLYILIAPFIIVLWCVMNPGKVWQQAKKDFGVE* |
| Ga0129333_104773351 | 3300010354 | Freshwater To Marine Saline Gradient | MIPWYRKLVYILIAPFIIVLWCIMNPGKVWEQAKKD |
| Ga0129333_112840992 | 3300010354 | Freshwater To Marine Saline Gradient | MMNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFGVE* |
| Ga0129333_116645393 | 3300010354 | Freshwater To Marine Saline Gradient | MIMPWYKKLLLIIIAPFVIGAWCIMNPWKLWEQAKKDFG |
| Ga0129336_105001843 | 3300010370 | Freshwater To Marine Saline Gradient | MNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFGVE |
| Ga0133913_102493364 | 3300010885 | Freshwater Lake | MMPWYKKLLLIIIAPFVIGAWCVMNPRRVWEQAKKDFGVEL* |
| Ga0133913_102560852 | 3300010885 | Freshwater Lake | MPWYKKLLLMIIAPFVIGAWCIMNPRKVWEQAKKDFGVEE* |
| Ga0133913_102606318 | 3300010885 | Freshwater Lake | PWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE* |
| Ga0133913_116583212 | 3300010885 | Freshwater Lake | MIRKYRIILYILIAPFIIGAWCVMNPRKVWEQAKKDFGVE* |
| Ga0133913_118938192 | 3300010885 | Freshwater Lake | MMTDKLRGYKKLVFMIIAPFIIGAWCVMNPRKVWEQAKKDFGVKE* |
| Ga0153800_10173523 | 3300011995 | Freshwater | MIPWYKKLLYIVIAPFIIGAWCIMNPRKVWEQAKKDFGVEE* |
| Ga0153801_10113121 | 3300012017 | Freshwater | MIMPWYKNLLYILIAPFIIGAWCIMNPRKVWEQAKK |
| Ga0157210_10323293 | 3300012665 | Freshwater | MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVKE* |
| Ga0136642_10666943 | 3300013285 | Freshwater | MMPWYKKLLYIFIAPFIIGAWCIMNPRRVWEQAKKDFGVEE* |
| Ga0136642_10925953 | 3300013285 | Freshwater | MMPWYKKLLYIFIAPFIIGAWCIMNPRRVWEQAKKDFGVKE* |
| Ga0177922_101359003 | 3300013372 | Freshwater | MMPWYRKVLLIIVAPFIIGAWCIMNPRKVWEQAKKDYNL* |
| Ga0177922_105399862 | 3300013372 | Freshwater | MLPLYRKVLLIIVAPFIIGAWCIMNPRKVWEQAKKDYNI* |
| Ga0181344_10649762 | 3300017754 | Freshwater Lake | MMPWYKKIGYLAIAPFIIGAWCVMNPKKVWEQAKKDLLRK |
| Ga0181344_11538142 | 3300017754 | Freshwater Lake | YKKIGYLAIAPFIIGAWCVMNPKKVWEQAKKDLLRK |
| Ga0181356_11589973 | 3300017761 | Freshwater Lake | MISGYKKLVYIFIAPFVIGAWCVMNPRKVWEQAKKDFGVEL |
| Ga0181357_13304232 | 3300017777 | Freshwater Lake | MISGYKKLVYIFIAPFVIGAWCVMNPRKVWEQAKKDFGVEE |
| Ga0181349_10727942 | 3300017778 | Freshwater Lake | MMPWYKKLFIMIIAPFIIGAWCIMNPRRVWAQAKKDFGVKE |
| Ga0211732_15984533 | 3300020141 | Freshwater | MPWYKKLFIIIIAPFVIGAWCIMNPRKVWEQAKKDFGVEE |
| Ga0211726_104284301 | 3300020161 | Freshwater | MPWYKKLLLMIIAPFIIGAWCVMNPRKVWVQAKKDFGVKE |
| Ga0211726_106699103 | 3300020161 | Freshwater | MPWYRKLLLVVIAPFVIGAWCVMNPRLVWQQAKKDFGLEE |
| Ga0211735_114746352 | 3300020162 | Freshwater | MTPWYKKLLLIIIAPVVIGAWCIMNPRKVWEQAKKDFGVEE |
| Ga0214206_10042137 | 3300021131 | Freshwater | MMPWYKKLLYIIIAPFIIGAWCLMNPRKVWEQAKKDFGVEE |
| Ga0181353_10415373 | 3300022179 | Freshwater Lake | MSWYKKLLYILIAPFIIGTWCVMNPRKVWEQAKKDFGVEE |
| Ga0181353_10489402 | 3300022179 | Freshwater Lake | MSWYKKLLYILIAPFIIGTWCVMNPRKVWEQAKKDFGVEQ |
| Ga0181353_10799022 | 3300022179 | Freshwater Lake | MSDKLREYKKLLFMIIAPFIIGAWCVMNPRKVWEQAKKDWG |
| Ga0212088_103521583 | 3300022555 | Freshwater Lake Hypolimnion | MMPWYKKLLLLLIAPFVIGAWCIMNPRRVWEQAKKDFGVEE |
| Ga0214917_1001376214 | 3300022752 | Freshwater | MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEQ |
| Ga0244775_101281972 | 3300024346 | Estuarine | MNIPWYRKILYIIIAPVIIGAWMISNPRKVWEQAKKEWNIK |
| Ga0244775_107409123 | 3300024346 | Estuarine | MPWYKKLLLIIIAPFVIGAWCIMNPRRVWEQAKKDFGVEL |
| Ga0208974_10003384 | 3300027608 | Freshwater Lentic | MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVKE |
| Ga0209033_10045473 | 3300027697 | Freshwater Lake | MMPWYRKVLLIILAPFIIGAWCIMNPRKVWEQAKKDYNL |
| Ga0209188_12290734 | 3300027708 | Freshwater Lake | MIPWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGV |
| Ga0209499_10898584 | 3300027712 | Freshwater Lake | MIPWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE |
| Ga0209297_13599162 | 3300027733 | Freshwater Lake | MMPWYKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE |
| Ga0209085_100028622 | 3300027741 | Freshwater Lake | MIPWYKKLLLMIIAPFIIGAWCVMNPRKVWVQAKKDFGVKE |
| Ga0209192_101335474 | 3300027752 | Marine | MIPWYNKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE |
| Ga0209596_1000019226 | 3300027754 | Freshwater Lake | MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKHFGDKE |
| Ga0209596_10948025 | 3300027754 | Freshwater Lake | MMPWYKKLLLIIIAPFIIGAWCIMNPSKVWKQAKKDFGVEE |
| Ga0209296_10113582 | 3300027759 | Freshwater Lake | MMPWYKKLLLIIIAPFVIGAWCVMNPRRVWEQAKKDFGVEL |
| Ga0209296_11152862 | 3300027759 | Freshwater Lake | MPWHKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE |
| Ga0209500_100452063 | 3300027782 | Freshwater Lake | MMTWYKKLLFMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEEN |
| Ga0209500_102349392 | 3300027782 | Freshwater Lake | MSWYKKLLLIIIAPFVIGAWCIMNPRKVWEQAKKDFGVTE |
| Ga0209107_101330642 | 3300027797 | Freshwater And Sediment | MIPWYKKLLYIVIAPFIIGAWCIMNPRKVWEQAKKDFGVEE |
| Ga0209107_102433574 | 3300027797 | Freshwater And Sediment | MMPWYKKLLLMIIAPFIIGAWCIMNPRRVWDQAKKDFGVKE |
| Ga0209229_101403123 | 3300027805 | Freshwater And Sediment | MIRKLLYLIIAPFVIGAWCVMNPRKVWEQAKKEYGIEE |
| Ga0209229_101807082 | 3300027805 | Freshwater And Sediment | MMPWYKKLLLIIIAPFVIGAWCIMNPRKVWEQAKKDFGVKL |
| Ga0209229_103402092 | 3300027805 | Freshwater And Sediment | MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVEE |
| Ga0209400_10219212 | 3300027963 | Freshwater Lake | MPWYKKLLLLLIAPFIIGAWCVMNPRRVWEQAKKDFGVE |
| Ga0304730_12033281 | 3300028394 | Freshwater Lake | PWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE |
| Ga0315899_111624442 | 3300031784 | Freshwater | MTPWYKKLLLIIIAPVVIGAWCIMNPRKVWEQAKKDFGVKE |
| Ga0315909_108896671 | 3300031857 | Freshwater | MIPLYRKLLYILIAPFIIVLWCVMNPGKVWEQAKKDC |
| Ga0334980_0020249_1259_1384 | 3300033816 | Freshwater | MIMPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGFE |
| Ga0334977_0001049_7611_7736 | 3300033978 | Freshwater | MPWYKNLLYILIAPFIIGAWCIMNPRKVWEQAKKDFGINNE |
| Ga0335000_0200432_291_413 | 3300034063 | Freshwater | MMPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGVE |
| Ga0335036_0003714_7044_7163 | 3300034106 | Freshwater | MPWYKKLLYILIAPFIIGAWCIVNPRKVWEQAKKDFGVE |
| Ga0335036_0142221_304_423 | 3300034106 | Freshwater | MPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGFE |
| ⦗Top⦘ |