


| Basic Information | |
|---|---|
| Family ID | F092027 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 7.48 % |
| % of genes near scaffold ends (potentially truncated) | 27.10 % |
| % of genes from short scaffolds (< 2000 bps) | 71.03 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (57.009 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (37.383 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.682 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.224 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.26% β-sheet: 0.00% Coil/Unstructured: 59.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00303 | Thymidylat_synt | 16.82 |
| PF00709 | Adenylsucc_synt | 2.80 |
| PF01145 | Band_7 | 1.87 |
| PF06508 | QueC | 1.87 |
| PF07460 | NUMOD3 | 1.87 |
| PF05496 | RuvB_N | 1.87 |
| PF00004 | AAA | 1.87 |
| PF10504 | DUF2452 | 1.87 |
| PF00085 | Thioredoxin | 1.87 |
| PF00294 | PfkB | 0.93 |
| PF14284 | PcfJ | 0.93 |
| PF00149 | Metallophos | 0.93 |
| PF07728 | AAA_5 | 0.93 |
| PF01242 | PTPS | 0.93 |
| PF07362 | CcdA | 0.93 |
| PF00156 | Pribosyltran | 0.93 |
| PF00118 | Cpn60_TCP1 | 0.93 |
| PF03104 | DNA_pol_B_exo1 | 0.93 |
| PF14063 | DUF4254 | 0.93 |
| PF00011 | HSP20 | 0.93 |
| PF05050 | Methyltransf_21 | 0.93 |
| PF01227 | GTP_cyclohydroI | 0.93 |
| PF02195 | ParBc | 0.93 |
| PF13394 | Fer4_14 | 0.93 |
| PF13583 | Reprolysin_4 | 0.93 |
| PF03851 | UvdE | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 16.82 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 2.80 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.87 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.87 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.87 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.87 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 1.87 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.93 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.93 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.93 |
| COG5302 | Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.64 % |
| Unclassified | root | N/A | 23.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001968|GOS2236_1072375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1588 | Open in IMG/M |
| 3300002202|metazooDRAFT_1249615 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300003852|Ga0031655_10318337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300004770|Ga0007804_1133976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300005662|Ga0078894_10150359 | All Organisms → Viruses → Predicted Viral | 2091 | Open in IMG/M |
| 3300005805|Ga0079957_1032560 | All Organisms → Viruses → Predicted Viral | 3428 | Open in IMG/M |
| 3300006092|Ga0082021_1106297 | Not Available | 44600 | Open in IMG/M |
| 3300006484|Ga0070744_10161792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300006639|Ga0079301_1113579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 821 | Open in IMG/M |
| 3300006802|Ga0070749_10158383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1313 | Open in IMG/M |
| 3300006805|Ga0075464_10893718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300006875|Ga0075473_10296113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300007094|Ga0102532_1122299 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin217 | 2149 | Open in IMG/M |
| 3300007165|Ga0079302_1130892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300007973|Ga0105746_1320355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300008072|Ga0110929_1002915 | Not Available | 9746 | Open in IMG/M |
| 3300008108|Ga0114341_10000190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 167479 | Open in IMG/M |
| 3300008108|Ga0114341_10011696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14580 | Open in IMG/M |
| 3300008266|Ga0114363_1054623 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300008267|Ga0114364_1005374 | Not Available | 6519 | Open in IMG/M |
| 3300008267|Ga0114364_1042732 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300008448|Ga0114876_1140582 | Not Available | 895 | Open in IMG/M |
| 3300009151|Ga0114962_10215628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
| 3300009151|Ga0114962_10273664 | Not Available | 953 | Open in IMG/M |
| 3300009151|Ga0114962_10569696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300009152|Ga0114980_10730438 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 553 | Open in IMG/M |
| 3300009155|Ga0114968_10209944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300009158|Ga0114977_10000406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29010 | Open in IMG/M |
| 3300009158|Ga0114977_10749876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300009159|Ga0114978_10040718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3261 | Open in IMG/M |
| 3300009159|Ga0114978_10316698 | Not Available | 951 | Open in IMG/M |
| 3300009159|Ga0114978_10508628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300009163|Ga0114970_10277428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300009169|Ga0105097_10448600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300009180|Ga0114979_10053866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2521 | Open in IMG/M |
| 3300009181|Ga0114969_10565968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300009182|Ga0114959_10116066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 1453 | Open in IMG/M |
| 3300009182|Ga0114959_10219001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 978 | Open in IMG/M |
| 3300009182|Ga0114959_10533761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300009183|Ga0114974_10599345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300009183|Ga0114974_10673607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300009184|Ga0114976_10284868 | Not Available | 888 | Open in IMG/M |
| 3300010158|Ga0114960_10000132 | Not Available | 56700 | Open in IMG/M |
| 3300010158|Ga0114960_10000235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45749 | Open in IMG/M |
| 3300010158|Ga0114960_10069910 | All Organisms → Viruses → Predicted Viral | 2019 | Open in IMG/M |
| 3300010158|Ga0114960_10585447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300010158|Ga0114960_10624876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 508 | Open in IMG/M |
| 3300010160|Ga0114967_10018920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4888 | Open in IMG/M |
| 3300010354|Ga0129333_10226577 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
| 3300010354|Ga0129333_11356901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300010885|Ga0133913_10256041 | All Organisms → Viruses → Predicted Viral | 4646 | Open in IMG/M |
| 3300010885|Ga0133913_10841759 | Not Available | 2387 | Open in IMG/M |
| 3300010885|Ga0133913_13129373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
| 3300011115|Ga0151514_10003 | Not Available | 160798 | Open in IMG/M |
| 3300011268|Ga0151620_1221595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300013295|Ga0170791_12047250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300017707|Ga0181363_1031379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1002 | Open in IMG/M |
| 3300017754|Ga0181344_1026775 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300017777|Ga0181357_1089611 | Not Available | 1173 | Open in IMG/M |
| 3300017784|Ga0181348_1324000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300019784|Ga0181359_1069424 | Not Available | 1337 | Open in IMG/M |
| 3300020530|Ga0208235_1020728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 806 | Open in IMG/M |
| 3300021354|Ga0194047_10126187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
| 3300021963|Ga0222712_10476918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300022179|Ga0181353_1162369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300022407|Ga0181351_1185733 | Not Available | 710 | Open in IMG/M |
| 3300022407|Ga0181351_1205866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300022752|Ga0214917_10362667 | Not Available | 614 | Open in IMG/M |
| 3300023174|Ga0214921_10000400 | Not Available | 82636 | Open in IMG/M |
| 3300023174|Ga0214921_10000566 | All Organisms → cellular organisms → Bacteria | 68258 | Open in IMG/M |
| 3300023184|Ga0214919_10000093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 138365 | Open in IMG/M |
| 3300023184|Ga0214919_10057013 | All Organisms → Viruses → Predicted Viral | 3661 | Open in IMG/M |
| 3300023184|Ga0214919_10149661 | Not Available | 1856 | Open in IMG/M |
| 3300025732|Ga0208784_1196004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300025889|Ga0208644_1071181 | All Organisms → Viruses → Predicted Viral | 1820 | Open in IMG/M |
| 3300025896|Ga0208916_10459982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300027631|Ga0208133_1040006 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300027708|Ga0209188_1000007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 257913 | Open in IMG/M |
| 3300027708|Ga0209188_1013287 | All Organisms → Viruses → Predicted Viral | 4517 | Open in IMG/M |
| 3300027708|Ga0209188_1118190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 1039 | Open in IMG/M |
| 3300027733|Ga0209297_1000068 | Not Available | 75502 | Open in IMG/M |
| 3300027734|Ga0209087_1211668 | Not Available | 737 | Open in IMG/M |
| 3300027749|Ga0209084_1166886 | Not Available | 910 | Open in IMG/M |
| 3300027754|Ga0209596_1329102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300027782|Ga0209500_10226566 | Not Available | 829 | Open in IMG/M |
| 3300027805|Ga0209229_10092568 | Not Available | 1360 | Open in IMG/M |
| 3300027805|Ga0209229_10252221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300027896|Ga0209777_10749465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300027896|Ga0209777_10991808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300027899|Ga0209668_10328932 | Not Available | 987 | Open in IMG/M |
| 3300027899|Ga0209668_10836959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300028393|Ga0304728_1015260 | All Organisms → Viruses → Predicted Viral | 3612 | Open in IMG/M |
| 3300028393|Ga0304728_1021633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2919 | Open in IMG/M |
| 3300028393|Ga0304728_1314669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 503 | Open in IMG/M |
| 3300028394|Ga0304730_1067774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1658 | Open in IMG/M |
| 3300031746|Ga0315293_10136156 | All Organisms → Viruses → Predicted Viral | 2060 | Open in IMG/M |
| 3300031758|Ga0315907_10361409 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300031787|Ga0315900_10010685 | Not Available | 11455 | Open in IMG/M |
| 3300031857|Ga0315909_10100455 | Not Available | 2495 | Open in IMG/M |
| 3300031963|Ga0315901_10613020 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin217 | 824 | Open in IMG/M |
| 3300032050|Ga0315906_10028627 | Not Available | 6061 | Open in IMG/M |
| 3300032053|Ga0315284_11039858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300033993|Ga0334994_0118289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1532 | Open in IMG/M |
| 3300034061|Ga0334987_0266603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
| 3300034102|Ga0335029_0261745 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300034103|Ga0335030_0597480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300034283|Ga0335007_0471215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 37.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.28% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.61% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.67% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.87% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.87% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.87% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.93% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.93% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2236_10723752 | 3300001968 | Marine | MNLKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKNVINQMNNEQPR* |
| metazooDRAFT_12496152 | 3300002202 | Lake | MKKKQRIIKVPVPKEIWDADMSIWNWNRDIFGAWAKSIVNVVKQLEK* |
| Ga0031655_103183372 | 3300003852 | Freshwater Lake Sediment | MSKRIIKVEVPKEIWDASMSIWNWRRDIMGAWMKSISDVVKQFEDKK* |
| Ga0007804_11339762 | 3300004770 | Freshwater | MSRKIIKVEVPKEIWDAHMSIWNILFGRRDIMGAWMKSISDVVKQFEDKK* |
| Ga0078894_101503596 | 3300005662 | Freshwater Lake | MNSKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNEQLR* |
| Ga0079957_10325605 | 3300005805 | Lake | MNLKNRRIIKVEVPKDIWDAHMSIWNWRQDILGSWMKSIKNVIKQMDNEQLR* |
| Ga0082021_110629733 | 3300006092 | Wastewater Treatment Plant | MKKKQRVIKVQVPKEIWDADMSIWNWNRDIMGAWMRSIVDVIKQLEK* |
| Ga0070744_101617922 | 3300006484 | Estuarine | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSVVSIVNQIKH* |
| Ga0079301_11135791 | 3300006639 | Deep Subsurface | NNMSDVDRKVIKVEVPKDIWDADMSIWNWRRDIMGSWMKSIKDVIKQMRYERS* |
| Ga0070749_101583832 | 3300006802 | Aqueous | MNLKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNE* |
| Ga0075464_108937182 | 3300006805 | Aqueous | MSRKIIKVEVPKEIWDAQMSIWNWRRDIMGAWMKSISDVVKQFEDKK* |
| Ga0075473_102961132 | 3300006875 | Aqueous | MKDKRIIKVEVPKEIWDAHMSIWNWRRDIMGAWMKSISDVIKQFENKK* |
| Ga0102532_11222994 | 3300007094 | Freshwater Lake | MKIKRIIKVEVPKEIWDADMSIWNVLFMRKDIMGAWMKSIVEVVKQKY* |
| Ga0079302_11308922 | 3300007165 | Deep Subsurface | MSDVDRKVIKVEVPKDIWDADMSIWNWRRDIMGSWMKSIKDVIKQMRYERS* |
| Ga0105746_13203552 | 3300007973 | Estuary Water | MENRKIIKVEVPKEIWDADMSIWNMLFGRRDIMGAWMKSVVSIVNQIKH* |
| Ga0110929_100291514 | 3300008072 | Water Bodies | MNLKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNEQLR* |
| Ga0114341_10000190121 | 3300008108 | Freshwater, Plankton | MKKERIIYVEVPKEIWDAHNSIWNWRRDIIGAWVKSIKDVVNQMNKYENKTC* |
| Ga0114341_1001169620 | 3300008108 | Freshwater, Plankton | MERRIIKVEVPKEIWDADMSIWNILFGRRDIMGAWMNSIVDVVKQLEKIN* |
| Ga0114363_10546232 | 3300008266 | Freshwater, Plankton | MYKYMKNKRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIQDVVNQIKH* |
| Ga0114364_10053749 | 3300008267 | Freshwater, Plankton | MYNMENRRVIKVEIPKEIWDADISFWNVLFGRRDIVGAWMKSVVSIVNQIKQ* |
| Ga0114364_10427323 | 3300008267 | Freshwater, Plankton | MNKKRIIKVEVPKEIWDADMSIWNVLFMRKDIMGAWMKSIVEVVKQN* |
| Ga0114876_11405822 | 3300008448 | Freshwater Lake | MENRRVIKVEVPKEIWDADMSIWNILFGRRDITGAWMKSIRDVINQIKH* |
| Ga0114962_102156283 | 3300009151 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0114962_102736643 | 3300009151 | Freshwater Lake | MKNRKIINVEVPKEIWDADHSIWNIIFMRKDIMGAWMESIKDVITQIKH* |
| Ga0114962_105696962 | 3300009151 | Freshwater Lake | MSRKILKVEVPKEIWDADMSIWNILFGRRDIMGAWMKSISDVVKQFEDKR* |
| Ga0114980_107304382 | 3300009152 | Freshwater Lake | MKNRKIIKVKVPKEIWDADMSIWNMLFGRRDITGAWMKSIADVINQIKH* |
| Ga0114968_102099444 | 3300009155 | Freshwater Lake | MNKQRRVIKVEVPKEIWDADMSIWNILFGRRDIVGAWMKSVVQVVNQTNKQ* |
| Ga0114977_100004069 | 3300009158 | Freshwater Lake | MNKEDRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ* |
| Ga0114977_107498762 | 3300009158 | Freshwater Lake | RIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0114978_100407184 | 3300009159 | Freshwater Lake | MKDKRIIKVEIPKEIWDAHMSIWNWKRDIMGAWMKSITDVIKQFEDKK* |
| Ga0114978_103166983 | 3300009159 | Freshwater Lake | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIADVINQIKH* |
| Ga0114978_105086281 | 3300009159 | Freshwater Lake | NNEDRRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0114970_102774282 | 3300009163 | Freshwater Lake | MNNEDRQIIKVEVPKEIWDADMSIWNVFFGRRDIMGAWMKSIVSVVNQIKK* |
| Ga0105097_104486002 | 3300009169 | Freshwater Sediment | MNKERRIINVEVPKEIWDAHMSIWNWRRDIMGVWMHSIKDVIKQMQKK* |
| Ga0114979_100538667 | 3300009180 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ* |
| Ga0114969_105659684 | 3300009181 | Freshwater Lake | YNMKNITIKDKDRKVINVEVPKEIWDADQSVWNVIFMRKDIMGAWMKSIKDVINQIKH* |
| Ga0114959_101160661 | 3300009182 | Freshwater Lake | NMKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ* |
| Ga0114959_102190011 | 3300009182 | Freshwater Lake | NNMKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSVVSVVNQIKK* |
| Ga0114959_105337611 | 3300009182 | Freshwater Lake | NNMKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0114974_105993451 | 3300009183 | Freshwater Lake | MNNEDRRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ* |
| Ga0114974_106736072 | 3300009183 | Freshwater Lake | LLLCNMKDKRIIKVEIPKEIWDAHMSIWNWKRDIMGAWMKSITDVIKQFEDKK* |
| Ga0114976_102848682 | 3300009184 | Freshwater Lake | MNNEDRRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIV |
| Ga0114960_100001321 | 3300010158 | Freshwater Lake | RQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0114960_100002351 | 3300010158 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSV |
| Ga0114960_100699107 | 3300010158 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSI |
| Ga0114960_105854471 | 3300010158 | Freshwater Lake | MNKEDRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSV |
| Ga0114960_106248761 | 3300010158 | Freshwater Lake | QVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSVVSVVNQIKK* |
| Ga0114967_1001892013 | 3300010160 | Freshwater Lake | MKNITIKDKDRKVINVEVPKEIWDADQSVWNVIFMRKDIMGAWMKSIKDVINQIKH* |
| Ga0129333_102265774 | 3300010354 | Freshwater To Marine Saline Gradient | MNKERRIIKVPVPKEIWDADMSIWNVLFGRRDIMGAWMNSIKDVIKQMNYE* |
| Ga0129333_113569012 | 3300010354 | Freshwater To Marine Saline Gradient | MNLKNRRIIKVEVPKDIWDAHMSIWNWRLDILGSWMKSIKDVIKQMDNKQLR* |
| Ga0133913_1025604110 | 3300010885 | Freshwater Lake | MNNEDRRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0133913_108417591 | 3300010885 | Freshwater Lake | KEIWDADHSIWNIIFMRKDIMGAWMESIKDVITQIKH* |
| Ga0133913_131293735 | 3300010885 | Freshwater Lake | KNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ* |
| Ga0151514_10003193 | 3300011115 | Freshwater | MENRRIIKVEVPKEIWDADMSIFNCNRSLVRAWMESIQDVISQLEK* |
| Ga0151620_12215952 | 3300011268 | Freshwater | LKKKKIIYVEVPKEIWDAHMSIWNWRKDIMGAWARSIQEVVKQIKTK* |
| Ga0170791_120472503 | 3300013295 | Freshwater | KVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH* |
| Ga0181363_10313792 | 3300017707 | Freshwater Lake | MNSKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNEQLR |
| Ga0181344_10267755 | 3300017754 | Freshwater Lake | MSKDRRVIKVQVPKEIWNAHMSIWNWRRDIMGAWMNSILDVIKQFKD |
| Ga0181357_10896111 | 3300017777 | Freshwater Lake | MNDVDRKVIKVEVPKDIWDADISIWNWKRDIMGSWMKSIKDVIKQMRDESGR |
| Ga0181348_13240002 | 3300017784 | Freshwater Lake | MNNENRQIIKVEVPKEIWDADMSIWNVFFGRRDIMGAWMKSIVSVINQIKK |
| Ga0181359_10694243 | 3300019784 | Freshwater Lake | MKSRQIIKIEIPKEIWDADMSIWNILFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0208235_10207281 | 3300020530 | Freshwater | KVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNEQTR |
| Ga0194047_101261874 | 3300021354 | Anoxic Zone Freshwater | MSKRIIKVEVPKEIWDASMSIWNCRRDIMGAWMKSISDVVKQLEDKKTKLK |
| Ga0222712_104769182 | 3300021963 | Estuarine Water | MKKKKIIYVEVPKEIWDAHMSIWNWRKDIMGAWARSIQEVVKQIKTK |
| Ga0181353_11623692 | 3300022179 | Freshwater Lake | MSDVDRKVIKVEVPKDIWDADMSIWNWRRDIMGSWMKSIKDVIKQMRYEQS |
| Ga0181351_11857332 | 3300022407 | Freshwater Lake | MKTIKIEGKDRKIIEVEVPKEIWDADNSVWNIIFGRRDIMGAWMNSIDSVVKKIKE |
| Ga0181351_12058661 | 3300022407 | Freshwater Lake | NERKVIKIPVPKEIWDAEMSIWNMFANKDIFGAWMKSILNVVNQMSKK |
| Ga0214917_103626672 | 3300022752 | Freshwater | MNNVDRKAVKVEVPKDIWDADISIWNWKRDIMGSWMKSIKDLIKQMRDEQSR |
| Ga0214921_10000400111 | 3300023174 | Freshwater | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ |
| Ga0214921_10000566120 | 3300023174 | Freshwater | MKNRKVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKK |
| Ga0214919_1000009365 | 3300023184 | Freshwater | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKK |
| Ga0214919_100570135 | 3300023184 | Freshwater | MKDKRIIKVEIPKEIWDAHMSIWNWKRDIMGAWMKSITDVIKQFEDKK |
| Ga0214919_101496611 | 3300023184 | Freshwater | MSNMENRKVIKVEVPKEIWDADMSIWNILFGRRIMVDWMK |
| Ga0208784_11960042 | 3300025732 | Aqueous | MKDKRIIKVEIPKEIWDVHMSIWNWKRDIMGAWMKSITDVIKQFENKK |
| Ga0208644_10711813 | 3300025889 | Aqueous | MNLKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNE |
| Ga0208916_104599822 | 3300025896 | Aqueous | MSRKIIKVEVPKEIWDAQMSIWNWRRDIMGAWMKSISDVVKQFEDKK |
| Ga0208133_10400062 | 3300027631 | Estuarine | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSVVSIVNQIKH |
| Ga0209188_1000007227 | 3300027708 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0209188_101328711 | 3300027708 | Freshwater Lake | KNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0209188_11181902 | 3300027708 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSVVSVVNQIKK |
| Ga0209297_1000068107 | 3300027733 | Freshwater Lake | MNKEDRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKQ |
| Ga0209087_12116681 | 3300027734 | Freshwater Lake | MNNEDRRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0209084_11668863 | 3300027749 | Freshwater Lake | MSRKIIKVEVPKEIWDADMSIWNILFGRRDIMGAWMKSISDVVKQFEDKR |
| Ga0209596_13291021 | 3300027754 | Freshwater Lake | TYNMKNITIKDKDRKVINVEVPKEIWDADQSVWNVIFMRKDIMGAWMKSIKDVINQIKH |
| Ga0209500_102265662 | 3300027782 | Freshwater Lake | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIADVINQIKH |
| Ga0209229_100925683 | 3300027805 | Freshwater And Sediment | MKTIKIEGKGRKIIEVEVPKEIWDADHSVWNIIFGRRDIMGAWMNSIDSVIKKIKE |
| Ga0209229_102522213 | 3300027805 | Freshwater And Sediment | MNNERKVIKIPVPKEIWDAEMSIWNMFANKDIFGAWMKSILNVVNQMSKK |
| Ga0209777_107494651 | 3300027896 | Freshwater Lake Sediment | MSKRIIKVEVPKEIWDASMSIWNWRRDIMGAWMKSISDVVKQFEDKK |
| Ga0209777_109918083 | 3300027896 | Freshwater Lake Sediment | MSKRIIKVEVPKEIWDASMSIWNWRRDIMGAWMKSIS |
| Ga0209668_103289322 | 3300027899 | Freshwater Lake Sediment | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0209668_108369591 | 3300027899 | Freshwater Lake Sediment | MAKKIIKVEVPKEIWDAHMSIWNWKRDIMGAWMKSISDVIKQFENKK |
| Ga0304728_10152609 | 3300028393 | Freshwater Lake | NRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0304728_102163312 | 3300028393 | Freshwater Lake | MKNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKS |
| Ga0304728_13146692 | 3300028393 | Freshwater Lake | QVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSVVSVVNQIKK |
| Ga0304730_10677746 | 3300028394 | Freshwater Lake | MKNITIKDKDRKVINVEVPKEIWDADQSVWNVIFMRKDIMGAWMKSIKDVINQIKH |
| Ga0315293_101361563 | 3300031746 | Sediment | MKNITIKDKDRKVINVEVPKEIWDADQSVWNVIFMRKDIMGAWMESIKDVINQIKH |
| Ga0315907_103614091 | 3300031758 | Freshwater | MKNKRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIQDVVNQIKH |
| Ga0315900_100106854 | 3300031787 | Freshwater | MKKERIIYVEVPKEIWDAHNSIWNWRRDIIGAWVKSIKDVVNQMNKYENKTC |
| Ga0315909_101004552 | 3300031857 | Freshwater | MNKERRIIKVEVPKDIWDAHMSIWNWRRDIMGAWMNSIKDVIKQTQKK |
| Ga0315901_106130203 | 3300031963 | Freshwater | KRNWVMKIKRIIKVEVPKEIWDADMSIWNVLFMRKDIMGAWMKSIVEVVKQKY |
| Ga0315906_100286279 | 3300032050 | Freshwater | MYKYMKNKRIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIQDVVNQIKH |
| Ga0315284_110398584 | 3300032053 | Sediment | MKNRKIIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIASIVNQIKQ |
| Ga0334994_0118289_1087_1245 | 3300033993 | Freshwater | MNLKNRRIIKVEVPKDIWDAHMSIWNWRRDILGSWMKSIKDVIKQMDNEQTR |
| Ga0334987_0266603_637_783 | 3300034061 | Freshwater | MNNERRIINVEVPKEIWDAHMSIWNWRSDIMGAWMNSIKDVIKQMQKK |
| Ga0335029_0261745_492_641 | 3300034102 | Freshwater | MSNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSVVNQIKH |
| Ga0335030_0597480_411_584 | 3300034103 | Freshwater | MNKERRIIKVPVPKEIWDADMSIWNVLFGRRDIMGAWMNSIKDVIKQIDNEHRTTGS |
| Ga0335007_0471215_632_760 | 3300034283 | Freshwater | MSNRQVIKVEVPKEIWDADMSIWNVLFGRRDIMGAWMKSIVSV |
| ⦗Top⦘ |