


| Basic Information | |
|---|---|
| Family ID | F091996 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MFPSRAPFFRDRLNPRAAEIAAWAEENKRGNLPVSPFAPS |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.31 % |
| % of genes near scaffold ends (potentially truncated) | 64.49 % |
| % of genes from short scaffolds (< 2000 bps) | 69.16 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.112 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (30.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 5.61 |
| PF02401 | LYTB | 4.67 |
| PF03780 | Asp23 | 3.74 |
| PF03618 | Kinase-PPPase | 3.74 |
| PF01041 | DegT_DnrJ_EryC1 | 2.80 |
| PF00528 | BPD_transp_1 | 2.80 |
| PF06245 | DUF1015 | 1.87 |
| PF03167 | UDG | 1.87 |
| PF08545 | ACP_syn_III | 1.87 |
| PF00082 | Peptidase_S8 | 1.87 |
| PF00203 | Ribosomal_S19 | 1.87 |
| PF01425 | Amidase | 1.87 |
| PF13672 | PP2C_2 | 0.93 |
| PF13191 | AAA_16 | 0.93 |
| PF01642 | MM_CoA_mutase | 0.93 |
| PF02812 | ELFV_dehydrog_N | 0.93 |
| PF02608 | Bmp | 0.93 |
| PF01979 | Amidohydro_1 | 0.93 |
| PF05681 | Fumerase | 0.93 |
| PF01820 | Dala_Dala_lig_N | 0.93 |
| PF05683 | Fumerase_C | 0.93 |
| PF03099 | BPL_LplA_LipB | 0.93 |
| PF02621 | VitK2_biosynth | 0.93 |
| PF00696 | AA_kinase | 0.93 |
| PF02578 | Cu-oxidase_4 | 0.93 |
| PF01326 | PPDK_N | 0.93 |
| PF00889 | EF_TS | 0.93 |
| PF01040 | UbiA | 0.93 |
| PF13559 | DUF4129 | 0.93 |
| PF13288 | DXPR_C | 0.93 |
| PF00266 | Aminotran_5 | 0.93 |
| PF01694 | Rhomboid | 0.93 |
| PF10128 | OpcA_G6PD_assem | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF01467 | CTP_transf_like | 0.93 |
| PF01578 | Cytochrom_C_asm | 0.93 |
| PF00885 | DMRL_synthase | 0.93 |
| PF00313 | CSD | 0.93 |
| PF13460 | NAD_binding_10 | 0.93 |
| PF02934 | GatB_N | 0.93 |
| PF01894 | UPF0047 | 0.93 |
| PF00988 | CPSase_sm_chain | 0.93 |
| PF14306 | PUA_2 | 0.93 |
| PF12836 | HHH_3 | 0.93 |
| PF00146 | NADHdh | 0.93 |
| PF13469 | Sulfotransfer_3 | 0.93 |
| PF08352 | oligo_HPY | 0.93 |
| PF00834 | Ribul_P_3_epim | 0.93 |
| PF02686 | Glu-tRNAGln | 0.93 |
| PF11946 | DUF3463 | 0.93 |
| PF00202 | Aminotran_3 | 0.93 |
| PF00291 | PALP | 0.93 |
| PF01960 | ArgJ | 0.93 |
| PF00814 | TsaD | 0.93 |
| PF02790 | COX2_TM | 0.93 |
| PF01098 | FTSW_RODA_SPOVE | 0.93 |
| PF02894 | GFO_IDH_MocA_C | 0.93 |
| PF01507 | PAPS_reduct | 0.93 |
| PF01513 | NAD_kinase | 0.93 |
| PF07040 | DUF1326 | 0.93 |
| PF01583 | APS_kinase | 0.93 |
| PF13407 | Peripla_BP_4 | 0.93 |
| PF02739 | 5_3_exonuc_N | 0.93 |
| PF01370 | Epimerase | 0.93 |
| PF07977 | FabA | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 9.35 |
| COG1302 | Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) family | Function unknown [S] | 3.74 |
| COG1806 | Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities) | Signal transduction mechanisms [T] | 3.74 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 2.80 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 2.80 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 2.80 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 2.80 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 2.80 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0185 | Ribosomal protein S19 | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 1.87 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 1.87 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.93 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.93 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.93 |
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.93 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.93 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.93 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.93 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.93 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.93 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0721 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.93 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.93 |
| COG1181 | D-alanine-D-alanine ligase or related ATP-grasp enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.93 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.93 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.93 |
| COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.93 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.93 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.93 |
| COG1951 | Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain | Energy production and conversion [C] | 0.93 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.93 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.11 % |
| Unclassified | root | N/A | 15.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_108729824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 810 | Open in IMG/M |
| 3300000956|JGI10216J12902_111375387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300001538|A10PFW1_10242293 | Not Available | 504 | Open in IMG/M |
| 3300001538|A10PFW1_11430066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300005103|Ga0066813_1012496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300005166|Ga0066674_10447075 | Not Available | 591 | Open in IMG/M |
| 3300005176|Ga0066679_10127942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300005176|Ga0066679_10402429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 897 | Open in IMG/M |
| 3300005181|Ga0066678_10039848 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300005447|Ga0066689_10583497 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005467|Ga0070706_100053289 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
| 3300005467|Ga0070706_100478791 | Not Available | 1158 | Open in IMG/M |
| 3300005518|Ga0070699_100029223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4753 | Open in IMG/M |
| 3300005546|Ga0070696_100661239 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005548|Ga0070665_102013800 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005552|Ga0066701_10016909 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300005553|Ga0066695_10892605 | Not Available | 508 | Open in IMG/M |
| 3300005557|Ga0066704_10812790 | Not Available | 581 | Open in IMG/M |
| 3300005576|Ga0066708_10649893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300006579|Ga0074054_10009784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300006796|Ga0066665_10324232 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300006845|Ga0075421_100333914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1835 | Open in IMG/M |
| 3300006852|Ga0075433_11695291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300009012|Ga0066710_103012622 | Not Available | 655 | Open in IMG/M |
| 3300009038|Ga0099829_10049380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3110 | Open in IMG/M |
| 3300009038|Ga0099829_10201221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1612 | Open in IMG/M |
| 3300009137|Ga0066709_100009872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8618 | Open in IMG/M |
| 3300009137|Ga0066709_103013495 | Not Available | 618 | Open in IMG/M |
| 3300009162|Ga0075423_11131261 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300010040|Ga0126308_10084882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1912 | Open in IMG/M |
| 3300010403|Ga0134123_11229233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300011269|Ga0137392_11601042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300011270|Ga0137391_10107443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2418 | Open in IMG/M |
| 3300011991|Ga0120153_1008015 | All Organisms → cellular organisms → Bacteria | 3030 | Open in IMG/M |
| 3300012001|Ga0120167_1048447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 942 | Open in IMG/M |
| 3300012199|Ga0137383_11135534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300012204|Ga0137374_10010774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10748 | Open in IMG/M |
| 3300012204|Ga0137374_10031157 | All Organisms → cellular organisms → Bacteria | 5829 | Open in IMG/M |
| 3300012206|Ga0137380_10029214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5083 | Open in IMG/M |
| 3300012207|Ga0137381_11398043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300012209|Ga0137379_10136886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2353 | Open in IMG/M |
| 3300012211|Ga0137377_10918700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300012211|Ga0137377_11711044 | Not Available | 550 | Open in IMG/M |
| 3300012285|Ga0137370_10205784 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012350|Ga0137372_10603596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300012355|Ga0137369_10005920 | All Organisms → cellular organisms → Bacteria | 12382 | Open in IMG/M |
| 3300012355|Ga0137369_10006644 | All Organisms → cellular organisms → Bacteria | 11669 | Open in IMG/M |
| 3300012357|Ga0137384_11405210 | Not Available | 546 | Open in IMG/M |
| 3300012374|Ga0134039_1241926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 531 | Open in IMG/M |
| 3300012398|Ga0134051_1070240 | Not Available | 690 | Open in IMG/M |
| 3300012929|Ga0137404_10095838 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300012930|Ga0137407_12344208 | Not Available | 510 | Open in IMG/M |
| 3300012972|Ga0134077_10468195 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300013296|Ga0157374_11488418 | Not Available | 700 | Open in IMG/M |
| 3300013297|Ga0157378_13258985 | Not Available | 504 | Open in IMG/M |
| 3300013772|Ga0120158_10008230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10080 | Open in IMG/M |
| 3300014827|Ga0120171_1042034 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300015053|Ga0137405_1356146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1955 | Open in IMG/M |
| 3300015077|Ga0173483_10425020 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300017654|Ga0134069_1271864 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300018051|Ga0184620_10193484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300018054|Ga0184621_10042713 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300018056|Ga0184623_10187476 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300018061|Ga0184619_10128654 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300018066|Ga0184617_1274184 | Not Available | 507 | Open in IMG/M |
| 3300018920|Ga0190273_12274551 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300019279|Ga0184642_1327947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300019867|Ga0193704_1049802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300019886|Ga0193727_1000395 | All Organisms → cellular organisms → Bacteria | 16654 | Open in IMG/M |
| 3300020002|Ga0193730_1012583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2406 | Open in IMG/M |
| 3300020002|Ga0193730_1066063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
| 3300021445|Ga0182009_10281471 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300022756|Ga0222622_10308828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
| 3300025904|Ga0207647_10210530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1123 | Open in IMG/M |
| 3300025912|Ga0207707_10800763 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300025927|Ga0207687_10366838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1177 | Open in IMG/M |
| 3300026326|Ga0209801_1001937 | All Organisms → cellular organisms → Bacteria | 12391 | Open in IMG/M |
| 3300026326|Ga0209801_1273770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300026552|Ga0209577_10023761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5394 | Open in IMG/M |
| 3300027882|Ga0209590_10013717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3900 | Open in IMG/M |
| 3300028705|Ga0307276_10002001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Carbonactinosporaceae → Carbonactinospora → Carbonactinospora thermoautotrophica | 2951 | Open in IMG/M |
| 3300028705|Ga0307276_10002654 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
| 3300028711|Ga0307293_10000111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19967 | Open in IMG/M |
| 3300028713|Ga0307303_10004788 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300028717|Ga0307298_10052206 | Not Available | 1121 | Open in IMG/M |
| 3300028718|Ga0307307_10121835 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300028721|Ga0307315_10020914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1697 | Open in IMG/M |
| 3300028721|Ga0307315_10224067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300028768|Ga0307280_10033287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1550 | Open in IMG/M |
| 3300028768|Ga0307280_10356263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300028771|Ga0307320_10095873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300028791|Ga0307290_10061679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1357 | Open in IMG/M |
| 3300028793|Ga0307299_10130347 | Not Available | 944 | Open in IMG/M |
| 3300028807|Ga0307305_10007073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4832 | Open in IMG/M |
| 3300028807|Ga0307305_10017553 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
| 3300028824|Ga0307310_10185562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 976 | Open in IMG/M |
| 3300028828|Ga0307312_10007278 | All Organisms → cellular organisms → Bacteria | 6022 | Open in IMG/M |
| 3300028828|Ga0307312_10014125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 4461 | Open in IMG/M |
| 3300028828|Ga0307312_10115070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1680 | Open in IMG/M |
| 3300028876|Ga0307286_10062354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| 3300028878|Ga0307278_10012802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3910 | Open in IMG/M |
| 3300028878|Ga0307278_10018564 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
| 3300028881|Ga0307277_10042199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1842 | Open in IMG/M |
| 3300028884|Ga0307308_10015941 | All Organisms → cellular organisms → Bacteria | 3406 | Open in IMG/M |
| 3300028885|Ga0307304_10000912 | All Organisms → cellular organisms → Bacteria | 7565 | Open in IMG/M |
| 3300028885|Ga0307304_10127661 | Not Available | 1042 | Open in IMG/M |
| 3300028885|Ga0307304_10585354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 30.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.02% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1087298242 | 3300000956 | Soil | MFPSRPPFFGFRLEARAAEIAADSEEEERGNLPVSPFAPSTAHVRRIRT* |
| JGI10216J12902_1113753872 | 3300000956 | Soil | VGETMFPPRAPFFKDRLSPRAAEIAASAEEKKRGNLTVSPFAPSLALEVAA* |
| A10PFW1_102422931 | 3300001538 | Permafrost | FFRDRLSAHGVATAAACAEEEEGGNLPVSPYAPSTAHRPKISR* |
| A10PFW1_114300662 | 3300001538 | Permafrost | RETMFPSRAPFFRDRLGPRAAEIAAWAEETKRGNLTVSPDAPSLAHWAGAQ* |
| Ga0066813_10124961 | 3300005103 | Soil | MFPSRAPFFRDRLNPRAAEIAAWAEENKRGNLPVSPFAPS |
| Ga0066674_104470752 | 3300005166 | Soil | MFPPRAPFFRDRLNARGVATAATTAEEKERGNLPVSPYAPSTAHRP |
| Ga0066679_101279423 | 3300005176 | Soil | MFPSRAPFFRDRLSPRAAEIAACAEENKRGNRTVSPVAPSLVHGPGVGP* |
| Ga0066679_104024292 | 3300005176 | Soil | MSVARLWDPFFRDRLSPRAALIAASAEEKKRGNLTVSRRGPSLAHMPGTGL* |
| Ga0066678_100398483 | 3300005181 | Soil | MFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRTVSPVAPSLAHGPGVGP* |
| Ga0066689_105834972 | 3300005447 | Soil | MFPSRAPSFRDRLDPRAAEIAAWAEEKARGNLPVFPYAPSTAHRPQVGL* |
| Ga0070706_1000532895 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPSRAPFFKDRLSPRAAEIAACAEDGDWGNLKVSPDAPSLDHGPGVGP* |
| Ga0070706_1004787912 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPLLDPFFPLRLSPRAAAIAARAEENKRGNLTVSPFAPSLAHWQRSRQ* |
| Ga0070699_1000292233 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPSRAPFLRDRLSARGVATAAANAEEKEWGNLPVSPYAPSTAHRPKAGR* |
| Ga0070696_1006612392 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPLLDPFFPLRLSARAAAIAARAEENKRGNLTVSPFAPSLAHWQRSRQ* |
| Ga0070665_1020138002 | 3300005548 | Switchgrass Rhizosphere | MFPSRAPFFRDRLSAHGVATAAVHAEEKEGGNLPVSPYAPSPTHRPEGVR* |
| Ga0066701_100169092 | 3300005552 | Soil | MFPSRAPFFRDRLSPRAAEIAACAEENNKGNLPAFPFAPSTAHRPENSR* |
| Ga0066695_108926051 | 3300005553 | Soil | MFPSRAPFFSDRLSARDVATAAANAEEKERGNLPVSPYAPSTAHRPE |
| Ga0066704_108127902 | 3300005557 | Soil | MFPSRAPFFSDRLSARDVATAAANAEEKERGNLPVSP |
| Ga0066708_106498931 | 3300005576 | Soil | ETMFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRTVSPVAPSLAHGPGVGT* |
| Ga0074054_100097841 | 3300006579 | Soil | MFPSRAPFFMDRLNPRAAEIAAWAEENDWGNLSVSPCAPSHVHRAETAR* |
| Ga0066665_103242322 | 3300006796 | Soil | MFPSRAPFFRDRLSPRAAEIAACAEENNKGNLPVSPYAPSTAHRPENSR* |
| Ga0075421_1003339143 | 3300006845 | Populus Rhizosphere | MFPSRPPFLGLRLEARAAEIAADSEEEERGNLPVSPFAPATAHVRRIRT* |
| Ga0075433_116952912 | 3300006852 | Populus Rhizosphere | MFPSRPPFLGLRLEARAAEIAADSEEEERGKLPVSPFAPATAHVRRIRT* |
| Ga0066710_1030126221 | 3300009012 | Grasslands Soil | MFPLSDPFFRYRLSPRAAEIAAWAEEKEGGNLTVSPDAPSLRHGPEICP |
| Ga0099829_100493804 | 3300009038 | Vadose Zone Soil | MFPSRAPFFRDRLSARGVATAAANAEEKERGNLPVSPYAPSTVHEPKSGP* |
| Ga0099829_102012211 | 3300009038 | Vadose Zone Soil | MSVARLWLARFFRDRLSARGVATAAANTEEKERGNLPVSPY |
| Ga0066709_1000098726 | 3300009137 | Grasslands Soil | MFPSRAPSFRDRLDPRAAEIAAWAEEQEGGNLTVSPDAPSTAHRPQVGL* |
| Ga0066709_1030134952 | 3300009137 | Grasslands Soil | MFPSRAPFFRCRLRPRAAEIAASAEEQEGGNLTVSPDAPSPA |
| Ga0075423_111312612 | 3300009162 | Populus Rhizosphere | MFPSRPPVFGLRLEARAAEIAADSEEEERGNLPVSPFAPATAHVRRIRT* |
| Ga0126308_100848822 | 3300010040 | Serpentine Soil | MFPSRAPFFKDRLSARAVAIAACAEEKKRGNLTVSPAAPSLAHRSKNDR* |
| Ga0134123_112292331 | 3300010403 | Terrestrial Soil | MFPLLDPFFTLRLSTRAAAIAARAEENKRGNLTVSPFAPSLAH |
| Ga0137392_116010422 | 3300011269 | Vadose Zone Soil | MFPSRALFFRDRLSPRGAEIAAWAEETEGGNLTVSPDAPSLAHWAEAD |
| Ga0137391_101074434 | 3300011270 | Vadose Zone Soil | MFPSRAPFFRNRLSPRAAEIAAWAEENERGNLPVSPYAPSLAHRLKGSR* |
| Ga0120153_10080152 | 3300011991 | Permafrost | MFPSRAPFFRGRLSPRAAEIAARAEEKEWGNLSVSPMAPSLDHGPKVGP* |
| Ga0120167_10484472 | 3300012001 | Permafrost | MFPSRAPFFRDRLSARGVATAAAYTEEKERGNLPVFP |
| Ga0137383_111355341 | 3300012199 | Vadose Zone Soil | MFPPRAPFFRDRLNPRAAEIAAWAEEKERGNLPVSPYAPSTAHRPKDGR |
| Ga0137374_100107748 | 3300012204 | Vadose Zone Soil | MFPSRAPFFRDRLSARDVATAAARTEEKERGNLPVSPYASSTTHRPEIGR* |
| Ga0137374_100311574 | 3300012204 | Vadose Zone Soil | MFPSRAPFFRGRLGPRAAEIAAWAEENAGGNLTVSPDAPSLAHGPGVGP* |
| Ga0137380_100292146 | 3300012206 | Vadose Zone Soil | MFPSRAPFFTFLLNPRAAEIAAWAEEKERGNLPVSPYAPSTAHGPEGGP* |
| Ga0137381_113980431 | 3300012207 | Vadose Zone Soil | SGETMFPLSDPFFRDRLSLRAAEIAAWAEEKERGNLTVSPEAPSLAHRPEGGR* |
| Ga0137379_101368864 | 3300012209 | Vadose Zone Soil | PFFRSRLSPRAAEIAAWAEEKDRGNRTVSPDAPSLAHGPGVGP* |
| Ga0137377_109187001 | 3300012211 | Vadose Zone Soil | MTVVRLRLAPFFRNRLSARDVTTAAANTEEKERGNLPVSPY |
| Ga0137377_117110441 | 3300012211 | Vadose Zone Soil | MFTSRAPFFRDRLSARAAEIAAWAEEDKRGNRPVSPFAPSTAHRPKSS |
| Ga0137370_102057841 | 3300012285 | Vadose Zone Soil | MFPPRAPFFRNRLAPRAAEIAARGEEKEPGNLPVSR |
| Ga0137372_106035961 | 3300012350 | Vadose Zone Soil | PFFKDRLSSRAAEIAACAEEQERGNLRVSPDAPSLAHGPKISR* |
| Ga0137369_1000592013 | 3300012355 | Vadose Zone Soil | MFSSRAPFFRGRLSPRAAEIAAWAEENAGGNLTVSPDGPSLAHGPGVGP* |
| Ga0137369_100066441 | 3300012355 | Vadose Zone Soil | MFPSRAPFFRDRLSARDVATAAAGAEEKEGGNLPVSPYAPSPAH |
| Ga0137384_114052101 | 3300012357 | Vadose Zone Soil | MFPSRAPFFRCRFRPRAAEIAAWAEEQEGGNLTVSPDAPSLAQWAE |
| Ga0134039_12419263 | 3300012374 | Grasslands Soil | MFPSRAPYFRERFGLRAAAIAARAEDEVGGNLTVSPEAP |
| Ga0134051_10702401 | 3300012398 | Grasslands Soil | MFPSRAPFFRDRLGPRAAEIAACAEENERENLPVC |
| Ga0137404_100958381 | 3300012929 | Vadose Zone Soil | MFPPRAPFFRNRLRGVGDATAATTPEEKQRGNLPVSP |
| Ga0137407_123442081 | 3300012930 | Vadose Zone Soil | PFFRDRLSPRAAEIAAWAEENDWGNLPVSPFAPSTAHRPEVGL* |
| Ga0134077_104681951 | 3300012972 | Grasslands Soil | GETMFPPLAPFFRSRLNTRAAQIAACAEEQEGGNVRVSPDAPSLAHRPETGR* |
| Ga0157374_114884183 | 3300013296 | Miscanthus Rhizosphere | LSAHGVATAAVHAEEKEGGNLPISPYAPSPTHRPEGVR* |
| Ga0157378_132589852 | 3300013297 | Miscanthus Rhizosphere | RETMFPSRAPFFMGRLDPRAAEIAAWAEETERGNRTVSPEAPSLAHWAKAAQ* |
| Ga0120158_100082302 | 3300013772 | Permafrost | MFPPRAPFFRSGLSARADATAVARAEEKERGNLPVSPFAPSPAHQPEIGR* |
| Ga0120171_10420342 | 3300014827 | Permafrost | MFPSRAPFFRDRLSARGVATAAARTEEKERGNLPVSPYAPS |
| Ga0137405_13561463 | 3300015053 | Vadose Zone Soil | RDRLSAHGVTTAAARTEEKERGNLPVSPDAPSTAQRPKVGR* |
| Ga0173483_104250201 | 3300015077 | Soil | MFPSRAPFFRERLSAHGVATAAPRTEEKVRGNLPVSPYAPSPAHRP |
| Ga0134069_12718642 | 3300017654 | Grasslands Soil | MFPSRAPFFRDRLKPRAAEIAAWAEENRRGNLPVSPFAPSTAQRP |
| Ga0184620_101934842 | 3300018051 | Groundwater Sediment | MFPSRAPFFRNRLSARAVATAAARTEEKARGNLPVSPY |
| Ga0184621_100427134 | 3300018054 | Groundwater Sediment | MFPSRAPFFRDRLSACGVATAAARTEERERGNLPVSPLAPS |
| Ga0184623_101874762 | 3300018056 | Groundwater Sediment | MFPPRAPFFKDRLDPRAAKIAAWGEEELGGNLTVSPDPPPT |
| Ga0184619_101286542 | 3300018061 | Groundwater Sediment | MFLARAPFFMDRLRARGVPTAAARTEEKKGGNLPVSPYAPLTAHRPQGAL |
| Ga0184617_12741841 | 3300018066 | Groundwater Sediment | MFPSGAPFFRDRLSPRAAEIAAWAEENMRGNLPVSPYAP |
| Ga0190273_122745512 | 3300018920 | Soil | MFPSRAPFFRDRLSAHSVATAAAGTEEKEGGNLPVSPYAPS |
| Ga0184642_13279471 | 3300019279 | Groundwater Sediment | MFPSRAPFFRDRLSARGITTAAATAEEKERGNLPVSPYAPSTAH |
| Ga0193704_10498021 | 3300019867 | Soil | MFPSRAPVFRNRLSPRAAEIAAWAEENAGGNLPVSLTPL |
| Ga0193727_100039510 | 3300019886 | Soil | MFPSRAPFFRDRLNPRAAEIAAWAEENKRGNLPVSLFAPSPHGPEIGP |
| Ga0193730_10125831 | 3300020002 | Soil | MFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRTVS |
| Ga0193730_10660632 | 3300020002 | Soil | MFPSRAPFFRNRLNPRAAEIAAWAEEKEGGNLPVSPYAPSTAHGPEG |
| Ga0182009_102814712 | 3300021445 | Soil | FPLLDAFFTPRLSPRAAAIAARAEENDRGNLTVSPGAPSLAHRPGPAR |
| Ga0222622_103088281 | 3300022756 | Groundwater Sediment | MFPSRASFFRSGLGPRAAEIAAWAEEKERGNLPVS |
| Ga0207647_102105304 | 3300025904 | Corn Rhizosphere | MFPSRAPFFRDRLSPRATEIAACAEEDKRGNPRVSPKAPSLAH |
| Ga0207707_108007633 | 3300025912 | Corn Rhizosphere | MFPSRAPFFRDRLSPRATEIAACAEEDKRGNPRVSPK |
| Ga0207687_103668383 | 3300025927 | Miscanthus Rhizosphere | SRAPFFRDRLSAHGVATAAVHAEEKEGGNLPISPYAPSPTHRPEGVR |
| Ga0209801_10019375 | 3300026326 | Soil | MFPSRAPFFRDRLSPRAAEIAACAEENNKGNLPAFPFAPSTAHRPENSR |
| Ga0209801_12737701 | 3300026326 | Soil | MFPSRAPFFRDRLSPRAAEIAACAEEKMRGNLPVSPYA |
| Ga0209577_100237613 | 3300026552 | Soil | MTSLVFGSLPFFRSRLSPPAAEIAAKAEEKEGGNLTVSPFAPSLRHAPEIGA |
| Ga0209590_100137174 | 3300027882 | Vadose Zone Soil | MSARKSRAPFFTDRLSPRAAEIAAWAEESTRGNLPVSPYAPSPHRSEIDR |
| Ga0307276_100020013 | 3300028705 | Soil | MFPSRAPFFRDRLNPRAAEIAAWAEEKKRGNLPVSPYAPSTAPRPKS |
| Ga0307276_100026544 | 3300028705 | Soil | MFPSRAPFFRDRLSARAAQIAALAEENERGNRAVSPGAPSLR |
| Ga0307293_1000011124 | 3300028711 | Soil | MFPSRAPVFRNRLSPRAAEIAAWAEENAGGNLPVSPYAP |
| Ga0307303_100047884 | 3300028713 | Soil | PFFRDRLNARSVATAAASAEEKERGNLPVSPYAPSTAHEPKVGS |
| Ga0307298_100522061 | 3300028717 | Soil | MFPSRAPFFRDRLNPRAAEIAAWAEEREWGNLSVSPGAP |
| Ga0307307_101218352 | 3300028718 | Soil | MFPSRAPFFRDRVNPRAAEIAAWAEENKRGNLPVSPFAPSPHGPEIGP |
| Ga0307315_100209141 | 3300028721 | Soil | MFPSRAPVFRNRLSPRAAEIAAWAEENAGGNLPVS |
| Ga0307315_102240672 | 3300028721 | Soil | MFPSRAPFFRDRLSSRAAEIAACAEEKERGNLSVS |
| Ga0307280_100332871 | 3300028768 | Soil | MFPSRAPFFRDRLSSRAAEIAACAEENEWGNLPVSPYAPS |
| Ga0307280_103562632 | 3300028768 | Soil | MFPRRAPFFRSRLDALAVATAAAGVEEKEGGNLPVS |
| Ga0307320_100958733 | 3300028771 | Soil | MFPSRAPFFKDRLSARDMATAAARTKEKERGNLAVSPYAPSPA |
| Ga0307290_100616791 | 3300028791 | Soil | MFPSQTPFFRDRLSARDGATAAARTVEKEWGNLPVSPYAP |
| Ga0307299_101303472 | 3300028793 | Soil | MFPPRAPFFRSRLDAHAVATAAAGVEEKEGGNLPVSPYAHSTAHRP |
| Ga0307305_100070739 | 3300028807 | Soil | MFPSRAPFFRDRLSARGITTAAATAEEKERGNLPISPYAPPT |
| Ga0307305_100175532 | 3300028807 | Soil | MFPSRASFFRSGLGPRAAEIAAWAEEKERGNLPVSPYAPSPLIGRTAADEL |
| Ga0307310_101855621 | 3300028824 | Soil | MFPSRAPFFRDRHNARAAEIAANAAEKGWGNLPVSP |
| Ga0307312_100072787 | 3300028828 | Soil | MFPSRAPFFKDRLSARDMATAAARTKEKERENLPVCPYAPSPAYRQESGR |
| Ga0307312_100141254 | 3300028828 | Soil | MFPSRVLFFRDRLSFRAAEIAACAEEKYGGSLPVPPGSPLPTHGPDGP |
| Ga0307312_101150703 | 3300028828 | Soil | APVRETMFPSRAPFFRDRVNPRAAEIAAWAEENKRGNLPVSPFAPSPHGPEIGP |
| Ga0307286_100623542 | 3300028876 | Soil | MFPSRAPFFRDRLNVRGVTTVAARTEEKIRGNRPVSPEAPST |
| Ga0307278_100128027 | 3300028878 | Soil | MFPSRAPFFRGRLSPRAAEIAAWAEEKSRGNLTVSPDAPSLAHGPGVGP |
| Ga0307278_100185645 | 3300028878 | Soil | MSVAPFFRDRLSARDLATAAANAEEKKRGNLPVSPYAPSPAHRLKGSR |
| Ga0307277_100421993 | 3300028881 | Soil | MFPSRAPFFRDRLNPHAAAIAAWAEEKEGGNLPVSPYAP |
| Ga0307308_100159414 | 3300028884 | Soil | MFPSRAPFFRGRLSPRAAEIAAWAEENKRGNLPVSPDAPSLAHGPGVGP |
| Ga0307304_1000091211 | 3300028885 | Soil | APFFRDRLSPRAAEIAAWAEEKEWGNLPVSPYAPSTAHRPQVGV |
| Ga0307304_101276611 | 3300028885 | Soil | GETMFPPRAPFFGDRLSARGVATAAASAEEKEWGNLPVSPYAPSPAHRPKGSR |
| Ga0307304_105853541 | 3300028885 | Soil | MFPPRAPFFRDRLSARAVATAAARTEEKEGGNLPVSPYA |
| ⦗Top⦘ |