


| Basic Information | |
|---|---|
| Family ID | F091946 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTSTPARSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHG |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.21 % |
| % of genes near scaffold ends (potentially truncated) | 94.39 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.579 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.206 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.29% Coil/Unstructured: 76.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02515 | CoA_transf_3 | 10.28 |
| PF13302 | Acetyltransf_3 | 6.54 |
| PF01977 | UbiD | 4.67 |
| PF00293 | NUDIX | 3.74 |
| PF07369 | DUF1488 | 2.80 |
| PF07978 | NIPSNAP | 2.80 |
| PF00296 | Bac_luciferase | 2.80 |
| PF01545 | Cation_efflux | 2.80 |
| PF04828 | GFA | 1.87 |
| PF02518 | HATPase_c | 1.87 |
| PF12973 | Cupin_7 | 1.87 |
| PF00300 | His_Phos_1 | 1.87 |
| PF00106 | adh_short | 0.93 |
| PF05239 | PRC | 0.93 |
| PF02441 | Flavoprotein | 0.93 |
| PF04226 | Transgly_assoc | 0.93 |
| PF00043 | GST_C | 0.93 |
| PF02586 | SRAP | 0.93 |
| PF01323 | DSBA | 0.93 |
| PF03435 | Sacchrp_dh_NADP | 0.93 |
| PF00239 | Resolvase | 0.93 |
| PF02796 | HTH_7 | 0.93 |
| PF08002 | DUF1697 | 0.93 |
| PF13358 | DDE_3 | 0.93 |
| PF02896 | PEP-utilizers_C | 0.93 |
| PF07690 | MFS_1 | 0.93 |
| PF13231 | PMT_2 | 0.93 |
| PF03773 | ArsP_1 | 0.93 |
| PF13419 | HAD_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 10.28 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 4.67 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 2.80 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 2.80 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.80 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 2.80 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.87 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.93 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.93 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.93 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.93 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.96 % |
| Unclassified | root | N/A | 28.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01BUOZA | Not Available | 524 | Open in IMG/M |
| 3300003223|JGI26343J46809_1006503 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300004082|Ga0062384_101286957 | Not Available | 535 | Open in IMG/M |
| 3300004092|Ga0062389_101740271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. J32 | 804 | Open in IMG/M |
| 3300005332|Ga0066388_100920840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1449 | Open in IMG/M |
| 3300005439|Ga0070711_100958225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300005536|Ga0070697_101808717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300005569|Ga0066705_10405872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300005576|Ga0066708_10725004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300005602|Ga0070762_10771289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300006028|Ga0070717_11377721 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006638|Ga0075522_10383462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300006800|Ga0066660_10612217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300009143|Ga0099792_10605670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300009162|Ga0075423_11813949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300010048|Ga0126373_10807612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300010361|Ga0126378_10504983 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300010366|Ga0126379_13061129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300010376|Ga0126381_100474552 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300011269|Ga0137392_10828538 | Not Available | 763 | Open in IMG/M |
| 3300011271|Ga0137393_11710756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300012207|Ga0137381_11432039 | Not Available | 583 | Open in IMG/M |
| 3300012361|Ga0137360_11119203 | Not Available | 680 | Open in IMG/M |
| 3300012917|Ga0137395_10680049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300012927|Ga0137416_11540977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300012971|Ga0126369_10178764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2025 | Open in IMG/M |
| 3300012985|Ga0164308_10638879 | Not Available | 910 | Open in IMG/M |
| 3300016270|Ga0182036_11356302 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300016294|Ga0182041_10620065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| 3300016357|Ga0182032_10946454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 734 | Open in IMG/M |
| 3300016371|Ga0182034_11191589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300016387|Ga0182040_10873652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300016404|Ga0182037_11200480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300020579|Ga0210407_11106384 | Not Available | 600 | Open in IMG/M |
| 3300020580|Ga0210403_10119750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2142 | Open in IMG/M |
| 3300020580|Ga0210403_10857620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300020581|Ga0210399_10548769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → unclassified Ktedonobacterales → Ktedonobacterales bacterium | 958 | Open in IMG/M |
| 3300020581|Ga0210399_11023051 | Not Available | 664 | Open in IMG/M |
| 3300020583|Ga0210401_11153067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia arida | 634 | Open in IMG/M |
| 3300021170|Ga0210400_10988465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 684 | Open in IMG/M |
| 3300021384|Ga0213876_10509184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300021388|Ga0213875_10591396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Zavarziniaceae → Zavarzinia | 536 | Open in IMG/M |
| 3300021401|Ga0210393_10430150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300021405|Ga0210387_11817021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300021406|Ga0210386_10872645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300021420|Ga0210394_11122224 | Not Available | 677 | Open in IMG/M |
| 3300021559|Ga0210409_10331475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → unclassified Ktedonobacterales → Ktedonobacterales bacterium | 1369 | Open in IMG/M |
| 3300021560|Ga0126371_11564881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 786 | Open in IMG/M |
| 3300021560|Ga0126371_11580962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 782 | Open in IMG/M |
| 3300021560|Ga0126371_11682394 | Not Available | 759 | Open in IMG/M |
| 3300022512|Ga0242676_1035650 | Not Available | 577 | Open in IMG/M |
| 3300022715|Ga0242678_1034247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300025915|Ga0207693_10881360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300025915|Ga0207693_11216704 | Not Available | 567 | Open in IMG/M |
| 3300025929|Ga0207664_10973553 | Not Available | 761 | Open in IMG/M |
| 3300026319|Ga0209647_1265926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300027069|Ga0208859_1020641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300027381|Ga0208983_1104657 | Not Available | 521 | Open in IMG/M |
| 3300027603|Ga0209331_1023417 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300027667|Ga0209009_1039501 | Not Available | 1172 | Open in IMG/M |
| 3300027889|Ga0209380_10005559 | Not Available | 7644 | Open in IMG/M |
| 3300027889|Ga0209380_10006380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7095 | Open in IMG/M |
| 3300027903|Ga0209488_10409437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1003 | Open in IMG/M |
| 3300028047|Ga0209526_10357962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300028536|Ga0137415_10943704 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300029910|Ga0311369_10642453 | Not Available | 879 | Open in IMG/M |
| 3300031057|Ga0170834_111211822 | Not Available | 1008 | Open in IMG/M |
| 3300031231|Ga0170824_119880684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. | 977 | Open in IMG/M |
| 3300031446|Ga0170820_11690491 | Not Available | 550 | Open in IMG/M |
| 3300031474|Ga0170818_109895799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1850 | Open in IMG/M |
| 3300031543|Ga0318516_10527600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 677 | Open in IMG/M |
| 3300031546|Ga0318538_10158881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1197 | Open in IMG/M |
| 3300031572|Ga0318515_10224947 | Not Available | 1006 | Open in IMG/M |
| 3300031573|Ga0310915_10256656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1230 | Open in IMG/M |
| 3300031668|Ga0318542_10463905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 657 | Open in IMG/M |
| 3300031708|Ga0310686_100941312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300031713|Ga0318496_10256241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 965 | Open in IMG/M |
| 3300031736|Ga0318501_10536900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300031744|Ga0306918_10418238 | Not Available | 1045 | Open in IMG/M |
| 3300031748|Ga0318492_10097883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1439 | Open in IMG/M |
| 3300031753|Ga0307477_10282512 | Not Available | 1147 | Open in IMG/M |
| 3300031764|Ga0318535_10530913 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031770|Ga0318521_10198055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1159 | Open in IMG/M |
| 3300031780|Ga0318508_1242891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031796|Ga0318576_10428915 | Not Available | 625 | Open in IMG/M |
| 3300031845|Ga0318511_10147157 | Not Available | 1028 | Open in IMG/M |
| 3300031845|Ga0318511_10269437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 766 | Open in IMG/M |
| 3300031879|Ga0306919_11279442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 556 | Open in IMG/M |
| 3300031945|Ga0310913_10782885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 673 | Open in IMG/M |
| 3300031954|Ga0306926_10722823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1206 | Open in IMG/M |
| 3300031962|Ga0307479_10340928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → unclassified Ktedonobacterales → Ktedonobacterales bacterium | 1482 | Open in IMG/M |
| 3300031981|Ga0318531_10472777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 568 | Open in IMG/M |
| 3300032001|Ga0306922_12094203 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032001|Ga0306922_12094724 | Not Available | 548 | Open in IMG/M |
| 3300032041|Ga0318549_10086973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1347 | Open in IMG/M |
| 3300032055|Ga0318575_10620865 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032059|Ga0318533_10599101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 809 | Open in IMG/M |
| 3300032059|Ga0318533_11085986 | Not Available | 586 | Open in IMG/M |
| 3300032065|Ga0318513_10488569 | Not Available | 602 | Open in IMG/M |
| 3300032068|Ga0318553_10778504 | Not Available | 501 | Open in IMG/M |
| 3300032076|Ga0306924_11223601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300032076|Ga0306924_11355115 | Not Available | 761 | Open in IMG/M |
| 3300032090|Ga0318518_10399329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300032174|Ga0307470_10824882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300032205|Ga0307472_102766594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032261|Ga0306920_101079372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1165 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_1582870 | 2035918004 | Soil | MTSTPARSGMPEHFGIRITDAAKDKLVGELDVDDRHLNNSG |
| JGI26343J46809_10065032 | 3300003223 | Bog Forest Soil | MPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0062384_1012869571 | 3300004082 | Bog Forest Soil | MTSIPTRSGMPGHFGIRIAKADKDKLVGELDVDDRHLNNS |
| Ga0062389_1017402711 | 3300004092 | Bog Forest Soil | MTLASARSGMPGHFGIRITQAEKDKLVGELDVDDRHLNNSGHVHGGAL |
| Ga0066388_1009208404 | 3300005332 | Tropical Forest Soil | MTSILVRSGMPQHFGIRIIEADKDKLVGELDVDDRHLNNSGHVHG |
| Ga0070711_1009582251 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSIPARSGMPEHFGIRITDADNDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0070697_1018087171 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTPIRSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALAA |
| Ga0066705_104058723 | 3300005569 | Soil | MTSTPSRSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGA |
| Ga0066705_107289142 | 3300005569 | Soil | MTSDTPRSGMPGHLGIRITDATKDRLTGEMDADERHLNAGGVVHGGALAAF |
| Ga0066708_107250042 | 3300005576 | Soil | MTSASARSGMPGHFGIRITSADKDKLVGELDVDDRHLNNS |
| Ga0070762_107712891 | 3300005602 | Soil | MTSTPGPSGMPEHFGIRITSAEKDKLVGELDVDHRHLNRS |
| Ga0070717_113777211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTPARSGMPGHFGIRIVEAAKDKLVGEMDADDRHLNNSGHV |
| Ga0075522_103834623 | 3300006638 | Arctic Peat Soil | MTSAVPTAGMPEHFGIRVTSTGKDKLVGEIDTDHRHLN |
| Ga0066660_106122171 | 3300006800 | Soil | MTATSHRPGMPEHFGIRVTSAEKDKLVGEFDVDDRHLNNGGHVHGGA |
| Ga0099792_106056702 | 3300009143 | Vadose Zone Soil | MTSTPSRSGVPGHFGIRITDAAKDKLVGELDVDDRHLNNSGHVHGG |
| Ga0075423_118139492 | 3300009162 | Populus Rhizosphere | MTSTSDRSGMPGYFGIRIVDADKDKLVGELDADDR |
| Ga0126373_108076121 | 3300010048 | Tropical Forest Soil | MTSFAVRSGMPGHFGIRITEADKDRLVGELDVDDRHLNNS |
| Ga0126378_105049831 | 3300010361 | Tropical Forest Soil | MPAHFGIRIADANKDKLVGELDVDERHLNNSDHVHGVSGIS |
| Ga0126379_130611292 | 3300010366 | Tropical Forest Soil | MTSTPARSGMPGHFGIRITDANKDRLVGELDVDDRHLNNSGHVHGGALA |
| Ga0126381_1004745523 | 3300010376 | Tropical Forest Soil | MTSSPARSGMPGHFGIRIADANKDKLVGELDVDDRQQ* |
| Ga0137392_108285381 | 3300011269 | Vadose Zone Soil | TMISILPRSGMPEHFGIRITSADKDKLVGEIDVDHRHLNVL* |
| Ga0137393_117107561 | 3300011271 | Vadose Zone Soil | MTSTPARSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVH |
| Ga0137381_114320392 | 3300012207 | Vadose Zone Soil | MTSLLARSGMPEHFGIRITSAEQDKLVGEIDVDQRHLNRGGCWRS* |
| Ga0137360_111192031 | 3300012361 | Vadose Zone Soil | MISILPRSGMPEHFGIRITSADKDKLVGEIDVDHRHLNVL* |
| Ga0137395_106800491 | 3300012917 | Vadose Zone Soil | MPGHFGIRVVEAAKDRLVGEMDADDRHLNNSGHVHG |
| Ga0137416_115409771 | 3300012927 | Vadose Zone Soil | MPGHFGIRITDANKDRLVGELDVNDRHLNNSGHVHGGALAAFGEPPRD |
| Ga0126369_101787643 | 3300012971 | Tropical Forest Soil | MTSASARSGMPAHFGIRIADANKDKLVGELDVDDHQQ* |
| Ga0164308_106388791 | 3300012985 | Soil | MSSNPRRPGMPGHFGIRITDAGKDRLVGELDVNDRHLNNSGHVH |
| Ga0182036_113563021 | 3300016270 | Soil | MTSTPARSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHG |
| Ga0182041_106200651 | 3300016294 | Soil | MTSNTAHSGMSGHFGIRIPDANKDRLVGELDVDDRH |
| Ga0182032_109464541 | 3300016357 | Soil | MTSTPARSGMPGHFGIRITNANKDKLVGELDVDDRHLNNGGHVHGGAL |
| Ga0182034_111915891 | 3300016371 | Soil | MTSNTAHSGMSGHFGIRIPDANKDRLVGELDVDDRHLNNSGHVHGGALAAFAD |
| Ga0182040_108736521 | 3300016387 | Soil | MTSNTAHYGMSGHFGIRITDANKDRLVGELDVDDRHLNNSSH |
| Ga0182037_112004802 | 3300016404 | Soil | MTSNTAHSGMSGHFGIRIPDANKDRLVGELDVDDRHLNNSSHVHGGALAA |
| Ga0210407_111063841 | 3300020579 | Soil | MTSTPAPSGMPEHFGIRITDSHRDKLVGELDVDDRHLNNSGHVHGG |
| Ga0210403_101197501 | 3300020580 | Soil | MPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGG |
| Ga0210403_108576201 | 3300020580 | Soil | MTSTPARSGMPEHFGIRTTDAKKDKLVGELDVDDRHLNNSGHVHGGA |
| Ga0210399_105487691 | 3300020581 | Soil | MTFTPAPSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALAAFA |
| Ga0210399_110230511 | 3300020581 | Soil | VLVDDLDPTRSGMPERFGIRITDAQKDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0210401_111530672 | 3300020583 | Soil | MTSTPARSGMPQHFGIRITDANKDRLVGELDVDDRHLNNSGHVH |
| Ga0210400_109884652 | 3300021170 | Soil | MTSTPARSGMPEHFGIRITDADKDKLVGELDVDDRHLNN |
| Ga0213876_105091842 | 3300021384 | Plant Roots | MSELSRPGMPGHFGIRIVSADKDKLTAEMEAGDRHVNNSGHVHGGALAAFA |
| Ga0213875_105913962 | 3300021388 | Plant Roots | MTSTPDRLGMPGHFGIRITAADKHQLVGELDADDRHLNNS |
| Ga0210393_104301503 | 3300021401 | Soil | MPGHFGIRITDADKDKLVGELDVDDRHLNNGGHVHGGALAAF |
| Ga0210387_118170211 | 3300021405 | Soil | MPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHG |
| Ga0210386_108726451 | 3300021406 | Soil | MTSTSDRSGMPGHFGIRITDADKDKLVGELDADDRHLNNSGHVHGGALAAFADD |
| Ga0210394_111222241 | 3300021420 | Soil | MTSTPARSGMPEHFGIRITDAAKDKLVGELDVDDRHLNNSGHAHG |
| Ga0210409_103314753 | 3300021559 | Soil | MPEHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALAAFA |
| Ga0126371_115648811 | 3300021560 | Tropical Forest Soil | MTSASARSGMPAHFGIRITNAERDKLVGELDVDDRHLNNSGHVHGGA |
| Ga0126371_115809622 | 3300021560 | Tropical Forest Soil | MPGHFGIRIIDANKDKLVGELDVDDRHLNNSGHVHG |
| Ga0126371_116823942 | 3300021560 | Tropical Forest Soil | MTSAPSRSGMPEYFGIRITQTDKDKLVGELDVDDRHLNNSGHVHGGALAAFA |
| Ga0242676_10356503 | 3300022512 | Soil | MTSTPARSGMPGHFGIRITDADKDKLVGELDVDDR |
| Ga0242678_10342471 | 3300022715 | Soil | MPQHFGIRITDANKDRLVGELGVDDRHLNNSGHVHGGA |
| Ga0207693_108813601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGHFGIRVIEAAKDRLVGEMDADDRHLNNSGHVHG |
| Ga0207693_112167041 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTPAHSGMPEHFGIRITDADRDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0207664_109735532 | 3300025929 | Agricultural Soil | MTSTPARSGMTGHFGIRVTDAAKDKLVGELDVDDRHLNNSGHV |
| Ga0209647_12659262 | 3300026319 | Grasslands Soil | MTTAPARRGMPGHFGIRIVSAEKDKLVGELDVDERHLNNSG |
| Ga0208859_10206411 | 3300027069 | Forest Soil | MTSTPARSGMPEHFGIRITDAAKDKLVGELDVDDRHLNNSGHVHGGALAAFADDL |
| Ga0208983_11046572 | 3300027381 | Forest Soil | MTSTPARSGMPEHFGIRITDSHRDKLVGELDVDDRHLNNSGHVHG |
| Ga0209331_10234173 | 3300027603 | Forest Soil | MTSTPTRSGMPGHFGIRITDAAKDKLVGELDVDDRHLNNSGHAHGGAL |
| Ga0209009_10395014 | 3300027667 | Forest Soil | MAADSTRSGMPGHFGIRITDAGKEKLVGELDVDDRHLNNSGH |
| Ga0209380_100055591 | 3300027889 | Soil | MTSTPARSGMPEHFGIRITDAAKDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0209380_100063801 | 3300027889 | Soil | MTSTPARSGMPGHFGIRITDAAKDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0209488_104094371 | 3300027903 | Vadose Zone Soil | MTETLPHTGMPEHFGIRITSLDKDKLVGELDVDHRHINNSGNVHGGALLAFADDLGG |
| Ga0209526_103579622 | 3300028047 | Forest Soil | MTSIPARSGMPGHFGIRITDSHKDKLVGELDVDDRHLNNSG |
| Ga0137415_109437042 | 3300028536 | Vadose Zone Soil | MTSTPPRSGMPGHFGIRVVEAAKDRLVGEMDADDRHLNN |
| Ga0311369_106424531 | 3300029910 | Palsa | MTAPYTNPGMPEYFGIRITSAEKDKLVGELDADHRHVNRGGHVHGGTL |
| Ga0170834_1112118223 | 3300031057 | Forest Soil | MTSNPARSGMPEHFGIRITDADKDKLVGELDVDDRHLNNSGHVPILQQM |
| Ga0170824_1198806842 | 3300031231 | Forest Soil | MTSTPARSGMPGHFGIRITDADKDKLVGELDVDDRHLNN |
| Ga0170820_116904911 | 3300031446 | Forest Soil | MTSTPAHSGMPEHFGIRITDADKDKLVGELDVDDRHLNNS |
| Ga0170818_1098957994 | 3300031474 | Forest Soil | MTSTPARSGMPEHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0318516_105276003 | 3300031543 | Soil | MTSTAARSGMPGHFGIRVTEADKDKLVGELDVDDRHLNNSGRVHGGAMAAF |
| Ga0318538_101588812 | 3300031546 | Soil | MTSTPARFGMPGHFGIRITDAGKDKLVGELDVDDRHLNN |
| Ga0318515_102249472 | 3300031572 | Soil | MTSTAARSGMPGHFGIRVTEADKDKLVGELDVDDRHLNNSGHVHGGA |
| Ga0310915_102566561 | 3300031573 | Soil | MTSTPARFGMPGHFGIRITDAGKDKLVGELDVDDRHLNNS |
| Ga0318542_104639051 | 3300031668 | Soil | MTSTPARSGMPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGA |
| Ga0310686_1009413121 | 3300031708 | Soil | MISDPARSGMPGHFGIRITDADKDKLVGELDADDRHVNNSGHVHGGALA |
| Ga0318496_102562411 | 3300031713 | Soil | MPGYFGIRITDANKDKLVGELDADDRHLNNSGPVHGGALAAFADDLGGA |
| Ga0318501_105369001 | 3300031736 | Soil | MPGHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALAAF |
| Ga0306918_104182382 | 3300031744 | Soil | MPGHFGIRVTEADKDKLVGELDVDDRHLNNSGRVHGG |
| Ga0318492_100978831 | 3300031748 | Soil | MTSTRTRSGMPGHFGIRITDANKDKLVGELDVDDRHLNNGGHVHGG |
| Ga0307477_102825121 | 3300031753 | Hardwood Forest Soil | MTSTPARSGMPEHFGIRITDANKDKLVGELDVDDRHLNNSGHVHGGALAAFA |
| Ga0318535_105309131 | 3300031764 | Soil | MTSTAARSGMPGHFGIRVTEADKDKLVGELDVDDRHLNNSGHVH |
| Ga0318521_101980552 | 3300031770 | Soil | MTSTPERSGMPGYFGIRITDANKDKLVGELDADDRHLNNSGPVH |
| Ga0318508_12428911 | 3300031780 | Soil | MPGYFGIRITDANKDKLVGELDADDRHLNNSGHVHGGALAAFADDLG |
| Ga0318576_104289152 | 3300031796 | Soil | MTSIPARSGMPVRFGIRITEADKDKLVGELDIDDRHLDNSDHVHGGALAAF |
| Ga0318511_101471571 | 3300031845 | Soil | MTSTAARSGMPGHFGIRVTEADKDKLVGELDVDDRHLNNSGHVHGG |
| Ga0318511_102694371 | 3300031845 | Soil | MTSTAARSGMPGHFGIRVTEADKDKLVGELDVDDRHLNNSGRVHGGA |
| Ga0306919_112794421 | 3300031879 | Soil | MTSTPARSGMPGHFGIRITNANKDKLVGELDVDDRHLNNS |
| Ga0310913_107828851 | 3300031945 | Soil | MTSTPARSGMPGHFGIRITDANKDKLVGELDVDDRHLNNSGHV |
| Ga0306926_107228231 | 3300031954 | Soil | MTSTLARSGMPAHFGIRIADADKDKLVGELDVDDRHLNNSGHVHGGALAA |
| Ga0307479_103409281 | 3300031962 | Hardwood Forest Soil | MPEHFGIRITDADKDKLVGELDVDDRHLNNSGHVHGGALA |
| Ga0318531_104727771 | 3300031981 | Soil | MTSTPARSGMPGHFGIRITDANKDKLVGELDVDDRHLNNSGHVHGGA |
| Ga0306922_120942032 | 3300032001 | Soil | MTSTAARSGMPGHFGIRVTEADKDKMVGELDVDDRHLNN |
| Ga0306922_120947242 | 3300032001 | Soil | MTSTPARSGMPGHFGIRIAKADKDKLVGELDVDDR |
| Ga0318549_100869731 | 3300032041 | Soil | MPVRFGIRITEADKDKLVGELDIDDRHLDNSDHVH |
| Ga0318575_106208652 | 3300032055 | Soil | MPGHFGIRVTEADKDKLVGELDVDDRHLNNSGRVHG |
| Ga0318533_105991012 | 3300032059 | Soil | MTSTPARSGMPGHFGIRITDANKDKLVGELDVDDRHLNNSGHVHG |
| Ga0318533_110859862 | 3300032059 | Soil | MTSTSVRSGMPGHFGIRVTEADKDRLVGELDVDDRHLNNSGHVHGGA |
| Ga0318513_104885692 | 3300032065 | Soil | MTFTAARSGMPGHFGIRVTEADKDKLVGELDVDDR |
| Ga0318553_107785042 | 3300032068 | Soil | MTSIPARSGMPVRFGIRITEADKDKLVGELDIDDRHLD |
| Ga0306924_112236012 | 3300032076 | Soil | MTSNTAHYGMSGHFGIRITDANKDRLVGELDVDDRHLNNSSHV |
| Ga0306924_113551152 | 3300032076 | Soil | MTSTAARSGMPGHFGIRVTEAEKDKLVGELDVDDRHLNNSGRVHG |
| Ga0318518_103993292 | 3300032090 | Soil | MTSTPARFGMPGHFGIRITDAGKDKLVGELDVDDRHLNNSGHVHG |
| Ga0307470_108248821 | 3300032174 | Hardwood Forest Soil | MTSIPVRSGMPGHFGIRITDANKDRLVGELDVNDR |
| Ga0307472_1027665942 | 3300032205 | Hardwood Forest Soil | MTSTPARSGMPGHFGIRITDAGKDRLVGELDVNDR |
| Ga0306920_1010793721 | 3300032261 | Soil | MTSTPARSGMPGHFGIRITDANKDKLVGELDVDDRHLNNSGHVHGGALA |
| ⦗Top⦘ |