


| Basic Information | |
|---|---|
| Family ID | F091893 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFDRFMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.31 % |
| % of genes near scaffold ends (potentially truncated) | 39.25 % |
| % of genes from short scaffolds (< 2000 bps) | 63.55 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (26.168 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (47.664 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.748 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (77.570 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 42.99 |
| PF10124 | Mu-like_gpT | 0.93 |
| PF03237 | Terminase_6N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 42.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.83 % |
| Unclassified | root | N/A | 26.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10042469 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10029613 | Not Available | 2574 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10125675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10215635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10228954 | Not Available | 578 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10273443 | All Organisms → Viruses → environmental samples → uncultured virus | 505 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10193686 | Not Available | 631 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10241065 | Not Available | 533 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10087651 | Not Available | 807 | Open in IMG/M |
| 3300001855|JGI2160J19893_10020456 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300001934|GOS2267_101158 | All Organisms → Viruses → environmental samples → uncultured virus | 833 | Open in IMG/M |
| 3300001963|GOS2229_1042534 | Not Available | 653 | Open in IMG/M |
| 3300005215|Ga0069001_10263754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300005512|Ga0074648_1018334 | Not Available | 4052 | Open in IMG/M |
| 3300005512|Ga0074648_1060055 | Not Available | 1567 | Open in IMG/M |
| 3300005611|Ga0074647_1002466 | Not Available | 6000 | Open in IMG/M |
| 3300005613|Ga0074649_1013112 | Not Available | 5458 | Open in IMG/M |
| 3300005613|Ga0074649_1018672 | Not Available | 4099 | Open in IMG/M |
| 3300006025|Ga0075474_10200742 | All Organisms → Viruses → environmental samples → uncultured virus | 611 | Open in IMG/M |
| 3300006027|Ga0075462_10009009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3230 | Open in IMG/M |
| 3300006734|Ga0098073_1008827 | Not Available | 1793 | Open in IMG/M |
| 3300006810|Ga0070754_10033319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2854 | Open in IMG/M |
| 3300006867|Ga0075476_10207082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
| 3300006869|Ga0075477_10398900 | All Organisms → Viruses → environmental samples → uncultured virus | 535 | Open in IMG/M |
| 3300006916|Ga0070750_10315967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300007345|Ga0070752_1335245 | All Organisms → Viruses → environmental samples → uncultured virus | 570 | Open in IMG/M |
| 3300007540|Ga0099847_1143220 | All Organisms → Viruses → environmental samples → uncultured virus | 713 | Open in IMG/M |
| 3300009027|Ga0102957_1165615 | All Organisms → Viruses → environmental samples → uncultured virus | 786 | Open in IMG/M |
| 3300010299|Ga0129342_1307211 | All Organisms → Viruses → environmental samples → uncultured virus | 544 | Open in IMG/M |
| 3300010300|Ga0129351_1393386 | All Organisms → Viruses → environmental samples → uncultured virus | 517 | Open in IMG/M |
| 3300010316|Ga0136655_1153519 | All Organisms → Viruses → environmental samples → uncultured virus | 687 | Open in IMG/M |
| 3300010370|Ga0129336_10127965 | Not Available | 1477 | Open in IMG/M |
| 3300017949|Ga0181584_10870929 | All Organisms → Viruses → environmental samples → uncultured virus | 529 | Open in IMG/M |
| 3300017950|Ga0181607_10022924 | Not Available | 4673 | Open in IMG/M |
| 3300017950|Ga0181607_10143446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1456 | Open in IMG/M |
| 3300017951|Ga0181577_10121111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1797 | Open in IMG/M |
| 3300017952|Ga0181583_10280414 | Not Available | 1066 | Open in IMG/M |
| 3300017967|Ga0181590_10019871 | Not Available | 5444 | Open in IMG/M |
| 3300018041|Ga0181601_10101849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1854 | Open in IMG/M |
| 3300018410|Ga0181561_10147643 | Not Available | 1208 | Open in IMG/M |
| 3300018876|Ga0181564_10661899 | All Organisms → Viruses → environmental samples → uncultured virus | 551 | Open in IMG/M |
| 3300019459|Ga0181562_10231573 | All Organisms → Viruses → environmental samples → uncultured virus | 950 | Open in IMG/M |
| 3300019701|Ga0194015_1026048 | All Organisms → Viruses → environmental samples → uncultured virus | 654 | Open in IMG/M |
| 3300019701|Ga0194015_1041695 | All Organisms → Viruses → environmental samples → uncultured virus | 555 | Open in IMG/M |
| 3300019721|Ga0194011_1013979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300019937|Ga0194022_1002024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2648 | Open in IMG/M |
| 3300020191|Ga0181604_10009933 | Not Available | 7074 | Open in IMG/M |
| 3300021958|Ga0222718_10005709 | Not Available | 10028 | Open in IMG/M |
| 3300021958|Ga0222718_10026528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3935 | Open in IMG/M |
| 3300021958|Ga0222718_10043682 | Not Available | 2896 | Open in IMG/M |
| 3300021958|Ga0222718_10064727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2258 | Open in IMG/M |
| 3300021958|Ga0222718_10148736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300021959|Ga0222716_10157754 | All Organisms → Viruses → environmental samples → uncultured virus | 1474 | Open in IMG/M |
| 3300021960|Ga0222715_10014862 | Not Available | 6017 | Open in IMG/M |
| 3300021960|Ga0222715_10074365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2259 | Open in IMG/M |
| 3300021964|Ga0222719_10373988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 895 | Open in IMG/M |
| 3300021964|Ga0222719_10505338 | All Organisms → Viruses → environmental samples → uncultured virus | 724 | Open in IMG/M |
| 3300022053|Ga0212030_1017073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300022063|Ga0212029_1012942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300022071|Ga0212028_1085035 | All Organisms → Viruses → environmental samples → uncultured virus | 590 | Open in IMG/M |
| 3300022158|Ga0196897_1009297 | All Organisms → Viruses | 1220 | Open in IMG/M |
| 3300022167|Ga0212020_1004569 | All Organisms → Viruses | 1812 | Open in IMG/M |
| 3300022169|Ga0196903_1030639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
| 3300022198|Ga0196905_1002627 | All Organisms → Viruses | 6691 | Open in IMG/M |
| 3300022198|Ga0196905_1007053 | All Organisms → Viruses | 3862 | Open in IMG/M |
| 3300022198|Ga0196905_1020636 | All Organisms → Viruses | 2065 | Open in IMG/M |
| 3300022198|Ga0196905_1144080 | All Organisms → Viruses | 615 | Open in IMG/M |
| 3300022200|Ga0196901_1013970 | All Organisms → Viruses | 3340 | Open in IMG/M |
| 3300022200|Ga0196901_1197929 | All Organisms → Viruses → environmental samples → uncultured virus | 646 | Open in IMG/M |
| 3300024262|Ga0210003_1020650 | All Organisms → Viruses | 4004 | Open in IMG/M |
| 3300025543|Ga0208303_1004532 | All Organisms → Viruses | 4856 | Open in IMG/M |
| 3300025543|Ga0208303_1013370 | All Organisms → Viruses | 2471 | Open in IMG/M |
| 3300025543|Ga0208303_1045811 | All Organisms → Viruses | 1085 | Open in IMG/M |
| 3300025543|Ga0208303_1119218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
| 3300025610|Ga0208149_1005513 | All Organisms → Viruses | 4112 | Open in IMG/M |
| 3300025647|Ga0208160_1005584 | All Organisms → cellular organisms → Bacteria | 4623 | Open in IMG/M |
| 3300025647|Ga0208160_1066377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 992 | Open in IMG/M |
| 3300025647|Ga0208160_1088738 | All Organisms → Viruses → environmental samples → uncultured virus | 818 | Open in IMG/M |
| 3300025647|Ga0208160_1134630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 3300025653|Ga0208428_1015977 | All Organisms → Viruses | 2530 | Open in IMG/M |
| 3300025655|Ga0208795_1014131 | All Organisms → Viruses | 2735 | Open in IMG/M |
| 3300025655|Ga0208795_1047123 | All Organisms → Viruses | 1288 | Open in IMG/M |
| 3300025655|Ga0208795_1067061 | Not Available | 1021 | Open in IMG/M |
| 3300025671|Ga0208898_1024017 | Not Available | 2616 | Open in IMG/M |
| 3300025671|Ga0208898_1085241 | All Organisms → Viruses → environmental samples → uncultured virus | 1003 | Open in IMG/M |
| 3300025674|Ga0208162_1014855 | All Organisms → Viruses | 3137 | Open in IMG/M |
| 3300025687|Ga0208019_1012376 | All Organisms → Viruses | 3575 | Open in IMG/M |
| 3300025759|Ga0208899_1005484 | All Organisms → Viruses | 7753 | Open in IMG/M |
| 3300025759|Ga0208899_1018784 | All Organisms → Viruses | 3517 | Open in IMG/M |
| 3300025759|Ga0208899_1024780 | All Organisms → Viruses | 2922 | Open in IMG/M |
| 3300025769|Ga0208767_1014638 | All Organisms → Viruses | 4626 | Open in IMG/M |
| 3300025771|Ga0208427_1006075 | All Organisms → Viruses | 4868 | Open in IMG/M |
| 3300025810|Ga0208543_1019300 | All Organisms → Viruses | 1734 | Open in IMG/M |
| 3300025815|Ga0208785_1028758 | Not Available | 1726 | Open in IMG/M |
| 3300025818|Ga0208542_1073182 | All Organisms → Viruses → environmental samples → uncultured virus | 1026 | Open in IMG/M |
| 3300027814|Ga0209742_10074393 | All Organisms → Viruses | 1109 | Open in IMG/M |
| 3300027917|Ga0209536_101440772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
| 3300028600|Ga0265303_10760219 | All Organisms → Viruses → environmental samples → uncultured virus | 794 | Open in IMG/M |
| 3300031539|Ga0307380_10124163 | All Organisms → Viruses | 2611 | Open in IMG/M |
| 3300031539|Ga0307380_10975462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
| 3300031669|Ga0307375_10402137 | Not Available | 849 | Open in IMG/M |
| 3300034374|Ga0348335_037174 | Not Available | 2043 | Open in IMG/M |
| 3300034374|Ga0348335_041938 | All Organisms → Viruses | 1861 | Open in IMG/M |
| 3300034374|Ga0348335_172523 | All Organisms → Viruses | 560 | Open in IMG/M |
| 3300034418|Ga0348337_026713 | Not Available | 2750 | Open in IMG/M |
| 3300034418|Ga0348337_120064 | Not Available | 808 | Open in IMG/M |
| 3300034418|Ga0348337_173138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 47.66% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.28% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 9.35% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.74% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.80% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.80% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.87% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.87% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.93% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.93% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.93% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001855 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 | Environmental | Open in IMG/M |
| 3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300005215 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019701 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019721 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100424692 | 3300000115 | Marine | MIDRFMYKILGSLDFLFDXIIPSIYERLKKIRIFSSRKRKTK* |
| DelMOSpr2010_100296137 | 3300000116 | Marine | ILGKLDFLFDNIIPNAYERLKNNRIFSSKKRKRK* |
| DelMOSpr2010_101256753 | 3300000116 | Marine | MIDKVMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRN |
| DelMOSpr2010_102156352 | 3300000116 | Marine | MFDRFMYKILGKLDFLFDNIIPSIYERLKKIRIFSKRKRNRK* |
| DelMOSpr2010_102289542 | 3300000116 | Marine | MFDRFMYKILGKLDFLFDNIIPSCYERLKKIRIFSRRKKDKR* |
| DelMOSpr2010_102734433 | 3300000116 | Marine | MFDRFMYKVLGKLDFLFEVAIPSIYERLKKIRIFSKRKRNRK* |
| DelMOWin2010_101936863 | 3300000117 | Marine | MIDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFFKRKRTKR* |
| DelMOWin2010_102410653 | 3300000117 | Marine | MIDRFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKAK* |
| BS_KBA_SWE02_21mDRAFT_100876514 | 3300000792 | Marine | LVVTSVVVKMIDRFMYKILGKLDFLFEVAIPSIYERLKKIRIFFKRKRTKR* |
| JGI2160J19893_100204564 | 3300001855 | Marine Sediment | MFDRFMYKVLGKLDFLFEVAIPSIYERLKKIRIFSRRKKAKR* |
| GOS2267_1011582 | 3300001934 | Marine | MFDRFMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR* |
| GOS2229_10425343 | 3300001963 | Marine | MIDRFMYKILGKLDFLFEVVIPSIYERLKKIRIFFKRKRNKR* |
| Ga0069001_102637542 | 3300005215 | Natural And Restored Wetlands | MFDRIMYKILGSLDFLFDVIIPSIYERLKKIRIFSRRKKTKR* |
| Ga0074648_10183346 | 3300005512 | Saline Water And Sediment | MFDKIMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR* |
| Ga0074648_10600552 | 3300005512 | Saline Water And Sediment | MFDKVMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR* |
| Ga0074647_10024665 | 3300005611 | Saline Water And Sediment | MFDKIMYKILGSLDFLFDVIIPSIYERLKKIRIFSARKRKTK* |
| Ga0074649_10131129 | 3300005613 | Saline Water And Sediment | MFDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRTKR* |
| Ga0074649_10186726 | 3300005613 | Saline Water And Sediment | MFDKIMYKILGKLDFLFDVVIPSIYERLKKIRIFSKRKRTKR* |
| Ga0075474_102007422 | 3300006025 | Aqueous | MFDKVMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNKR* |
| Ga0075462_100090092 | 3300006027 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKR* |
| Ga0098073_10088274 | 3300006734 | Marine | MFDKVMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNRK* |
| Ga0070754_100333192 | 3300006810 | Aqueous | MFDRFMYKVLGKLDFLFDNIIPTCYERLKKIRIFSRTKTKRK* |
| Ga0075476_102070824 | 3300006867 | Aqueous | ELLMFDRFMYKVLGKLDFLFDNIIPTCYERLKKIRIFSRTKTKRK* |
| Ga0075477_103989002 | 3300006869 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKK* |
| Ga0070750_103159671 | 3300006916 | Aqueous | MYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNKR* |
| Ga0070752_13352453 | 3300007345 | Aqueous | MFDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRK |
| Ga0099847_11432203 | 3300007540 | Aqueous | MFDKIMYSILGKLDFLFDNIIPSIYERLKNNRIFF |
| Ga0102957_11656153 | 3300009027 | Pond Water | MDMFDKVMYTILGKLDKLFEVIIPSIYERLKNNRIFSSKKRK |
| Ga0129342_13072111 | 3300010299 | Freshwater To Marine Saline Gradient | MFDRFMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRK |
| Ga0129351_13933862 | 3300010300 | Freshwater To Marine Saline Gradient | MFDRFMYSILGKLDFLFDNIIPNAYERLKNNRIFSS |
| Ga0136655_11535191 | 3300010316 | Freshwater To Marine Saline Gradient | MIDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFFK |
| Ga0129336_101279657 | 3300010370 | Freshwater To Marine Saline Gradient | MFDKFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKR |
| Ga0181584_108709291 | 3300017949 | Salt Marsh | MFDRFMYKILGKLDFLFDNIIPSIYERLKKIRIFSKRKRN |
| Ga0181607_100229242 | 3300017950 | Salt Marsh | MFDKFMYKVLGKLDFLFDNIIPSTYERLKKIRIFSRRKKTKR |
| Ga0181607_101434465 | 3300017950 | Salt Marsh | FDKFMYKILGKLDFLFDNIIPSIYERLKKIRIFSKRKRSRK |
| Ga0181577_101211113 | 3300017951 | Salt Marsh | MFDRIMYKILGSLDFLFDVTIPSIYERLKKIRIFSSRKRKTK |
| Ga0181583_102804142 | 3300017952 | Salt Marsh | MFDKFMYKILGKLDFLFDNIIPSIYERLKKIRIFSKRKRNKR |
| Ga0181590_100198717 | 3300017967 | Salt Marsh | MFDRFMYKVLGKLDFLFDNIIPTCYERLKKIRIFSRTKTKRK |
| Ga0181601_101018495 | 3300018041 | Salt Marsh | MFDKFMYKILGKLDFLFDNIIPSIYERLKKIRIFSKRKRSRK |
| Ga0181561_101476433 | 3300018410 | Salt Marsh | MFDRIMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0181564_106618993 | 3300018876 | Salt Marsh | MFDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKT |
| Ga0181562_102315735 | 3300019459 | Salt Marsh | MFDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSS |
| Ga0194015_10260483 | 3300019701 | Sediment | MIDRFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0194015_10416953 | 3300019701 | Sediment | MFDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0194011_10139791 | 3300019721 | Sediment | FDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0194022_10020242 | 3300019937 | Freshwater | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKK |
| Ga0181604_100099335 | 3300020191 | Salt Marsh | MFDKFMYKVLGKLDFLFDNIIPSCYERLKKIRIFSRRKKTKR |
| Ga0222718_100057096 | 3300021958 | Estuarine Water | MFDKFMYKVLGSLDFLFDVIIPNLYERLKNNRIFSSKKRKRK |
| Ga0222718_100265287 | 3300021958 | Estuarine Water | MFDRIMYKILGSLDFFFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0222718_100436823 | 3300021958 | Estuarine Water | MFDRIMYKILGSIDFLFDVTIPSIYERLKKIRIFSSRKRKTK |
| Ga0222718_100647275 | 3300021958 | Estuarine Water | MDMFDKVMYTILGKLDKLFEVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0222718_101487364 | 3300021958 | Estuarine Water | MDMFDRVMYTILGKLDKLFEVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0222716_101577543 | 3300021959 | Estuarine Water | MFDRFMYKVLGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR |
| Ga0222715_1001486213 | 3300021960 | Estuarine Water | MFDKFMYKVLGKLDFLFDKIIPSIYERLKKIRIFSRRKKTKR |
| Ga0222715_100743652 | 3300021960 | Estuarine Water | MFDRIMYKILGSIDFLFDVTIPSIYERLKKIRIFSSRKRKAK |
| Ga0222719_103739884 | 3300021964 | Estuarine Water | FMYKILGSIDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0222719_105053382 | 3300021964 | Estuarine Water | MDMFDKVMYTILGKLDNLFEVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0212030_10170734 | 3300022053 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFFKRKRTKK |
| Ga0212029_10129424 | 3300022063 | Aqueous | MDMFDRFMYKLLGSLDNLFEVIIPSIYERLKNNRIFSKRKRTKK |
| Ga0212028_10850351 | 3300022071 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKKY |
| Ga0196897_10092975 | 3300022158 | Aqueous | VELLMFDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0212020_10045695 | 3300022167 | Aqueous | MIDRFMYKILGKLDFLFDNIIPNAYERLKNNRIFSSKKRKRK |
| Ga0196903_10306391 | 3300022169 | Aqueous | FDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKK |
| Ga0196905_10026276 | 3300022198 | Aqueous | MFDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRTKR |
| Ga0196905_10070538 | 3300022198 | Aqueous | MFDKIMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR |
| Ga0196905_10206368 | 3300022198 | Aqueous | MFDKFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRTKR |
| Ga0196905_11440803 | 3300022198 | Aqueous | MFDRFMYKVLGKLDFLFEVAIPSTYERLKKIRIFFKRK |
| Ga0196901_10139701 | 3300022200 | Aqueous | FDRFMYSILGKLDFLFDNIIPNAYERLKNNRIFSSKKRKRK |
| Ga0196901_11979291 | 3300022200 | Aqueous | MFDRFMYKILGKLDFLFDNIIPSIYERLKKIRIFSKRKRIKR |
| Ga0210003_10206501 | 3300024262 | Deep Subsurface | RFMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNKK |
| Ga0208303_10045329 | 3300025543 | Aqueous | MFDKIMYSILGKLDFLFDNIIPSIYERLKNNRIFFKRKRTKK |
| Ga0208303_10133701 | 3300025543 | Aqueous | MFDKIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKK |
| Ga0208303_10458112 | 3300025543 | Aqueous | MFDKVMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNKR |
| Ga0208303_11192184 | 3300025543 | Aqueous | IMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKK |
| Ga0208149_10055138 | 3300025610 | Aqueous | MFDRFMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNKK |
| Ga0208160_10055841 | 3300025647 | Aqueous | LMFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKR |
| Ga0208160_10663774 | 3300025647 | Aqueous | YKILGKLDFLFEVAIPSIYERLKKIRIFSSRKRNKR |
| Ga0208160_10887381 | 3300025647 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTK |
| Ga0208160_11346301 | 3300025647 | Aqueous | LMFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRKRTKK |
| Ga0208428_10159775 | 3300025653 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSSKKRKRK |
| Ga0208795_10141315 | 3300025655 | Aqueous | MFDRFMYSILGKLDFLFDNIIPSIYERLKNNRIFSSKKRKRK |
| Ga0208795_10471231 | 3300025655 | Aqueous | MDMFDRFMYKLLGSLDNLFEVIIPSIYERLKNNRIFSKRKRTK |
| Ga0208795_10670615 | 3300025655 | Aqueous | KVELLMDMFDRFMYKLLGSLDNLFEVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0208898_10240177 | 3300025671 | Aqueous | MDMFDRFMYKLLGLLDNLFEVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0208898_10852411 | 3300025671 | Aqueous | MFDRIMYSILGKLDFLFDNIIPSIYERLKNNRIFSKRK |
| Ga0208162_10148552 | 3300025674 | Aqueous | MIDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKTK |
| Ga0208019_10123765 | 3300025687 | Aqueous | MFDKIMYSILGKLDFLFDNIIPSIYERLKNNRIFFKRKRIKK |
| Ga0208899_100548415 | 3300025759 | Aqueous | MFDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFSRRKKTKR |
| Ga0208899_10187846 | 3300025759 | Aqueous | MFDRFMYKVLGKLDFLFDTIIPSIYERLKKIRIFSKRKRNRK |
| Ga0208899_10247805 | 3300025759 | Aqueous | MIDRFMYKILGSLDNLFEVIIPSIYERLKNNRIFSKRKRTKK |
| Ga0208767_10146382 | 3300025769 | Aqueous | MIDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRTKK |
| Ga0208427_10060754 | 3300025771 | Aqueous | MIDRFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRTKR |
| Ga0208543_10193003 | 3300025810 | Aqueous | MFDKFMYKILGSLDFLFDVIIPNIYERLKKIRIFSSRKRKTK |
| Ga0208785_10287582 | 3300025815 | Aqueous | MFDRFMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRTKR |
| Ga0208542_10731821 | 3300025818 | Aqueous | MFDKVMYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNK |
| Ga0209742_100743934 | 3300027814 | Marine Sediment | MFDRFMYKILGKLDFLFEVAIPSTYERLKKIRILSTRKKTKR |
| Ga0209536_1014407724 | 3300027917 | Marine Sediment | MFDRFMYKVLGKLDFLFEVAIPSIYERLKKIRIFSKRKRIKK |
| Ga0265303_107602193 | 3300028600 | Sediment | MFDKFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRK |
| Ga0307380_101241637 | 3300031539 | Soil | MYKILGKLDFLFEVAIPSIYERLKKIRIFSKRKRNKK |
| Ga0307380_109754624 | 3300031539 | Soil | IDRFMYKILGKLDFLFEVAIPSIYERLKNNRIFSKRKRTKR |
| Ga0307375_104021371 | 3300031669 | Soil | KMIDRFMYKVLGKLDFLFEVAISSIYERLKKIRIFSKRKRTKR |
| Ga0348335_037174_437_565 | 3300034374 | Aqueous | MFDRIMYKILGSLDFLFDVIIPNIYERLKKIRIFSSRKRKAK |
| Ga0348335_041938_1542_1670 | 3300034374 | Aqueous | MIDRFMYKILGSLDFLFDVIIPSIYERLKKIRIFSSRKRKAK |
| Ga0348335_172523_330_458 | 3300034374 | Aqueous | MIDRFMYKVLGKLDFLFEVAIPSTYERLKKIRIFFKRKRTKR |
| Ga0348337_026713_1584_1712 | 3300034418 | Aqueous | MFDRIMYSILGKLDFLFDNFIPNQYERLKNNRIFSKRKRTKK |
| Ga0348337_120064_3_125 | 3300034418 | Aqueous | MDMFDRFMYKLLGLLDNLFEVIIPSIYERLKNNRIFSSKKR |
| Ga0348337_173138_456_575 | 3300034418 | Aqueous | RFMYKILGKLDFLFEVAIPSTYERLKKIRIFSKRKRTKR |
| ⦗Top⦘ |