


| Basic Information | |
|---|---|
| Family ID | F091832 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.89 % |
| % of genes near scaffold ends (potentially truncated) | 42.99 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.093 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (13.084 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.121 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (36.449 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF05532 | CsbD | 11.21 |
| PF01391 | Collagen | 4.67 |
| PF11752 | DUF3309 | 4.67 |
| PF13545 | HTH_Crp_2 | 2.80 |
| PF03631 | Virul_fac_BrkB | 2.80 |
| PF01594 | AI-2E_transport | 0.93 |
| PF08085 | Entericidin | 0.93 |
| PF02954 | HTH_8 | 0.93 |
| PF04228 | Zn_peptidase | 0.93 |
| PF12277 | DUF3618 | 0.93 |
| PF05494 | MlaC | 0.93 |
| PF07332 | Phage_holin_3_6 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 11.21 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.80 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.93 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG5510 | Predicted small secreted protein | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.09 % |
| Unclassified | root | N/A | 29.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100974804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300000890|JGI11643J12802_11608452 | Not Available | 1000 | Open in IMG/M |
| 3300002121|C687J26615_10031231 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300002681|Ga0005471J37259_122542 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300002908|JGI25382J43887_10335413 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300004643|Ga0062591_102800250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio → Thioalkalivibrio sp. AKL17 | 516 | Open in IMG/M |
| 3300005293|Ga0065715_10026083 | All Organisms → cellular organisms → Bacteria | 2706 | Open in IMG/M |
| 3300005327|Ga0070658_11489781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300005336|Ga0070680_100788583 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005354|Ga0070675_100039712 | All Organisms → cellular organisms → Bacteria | 3841 | Open in IMG/M |
| 3300005356|Ga0070674_100784085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia vestfoldensis | 822 | Open in IMG/M |
| 3300005367|Ga0070667_101314350 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005440|Ga0070705_100263617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1216 | Open in IMG/M |
| 3300005467|Ga0070706_100313211 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300005518|Ga0070699_101744456 | Not Available | 570 | Open in IMG/M |
| 3300005543|Ga0070672_100335096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300005546|Ga0070696_100303679 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005549|Ga0070704_101123011 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005558|Ga0066698_10145131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1599 | Open in IMG/M |
| 3300005563|Ga0068855_101462644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300006755|Ga0079222_10105842 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300006755|Ga0079222_11867457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300006847|Ga0075431_100796959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 918 | Open in IMG/M |
| 3300006918|Ga0079216_10079085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
| 3300009101|Ga0105247_11724435 | Not Available | 519 | Open in IMG/M |
| 3300009147|Ga0114129_11143452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300009147|Ga0114129_12902569 | Not Available | 567 | Open in IMG/M |
| 3300009609|Ga0105347_1088612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1154 | Open in IMG/M |
| 3300009609|Ga0105347_1302928 | Not Available | 671 | Open in IMG/M |
| 3300009610|Ga0105340_1114198 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300009678|Ga0105252_10592703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300009799|Ga0105075_1057584 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009817|Ga0105062_1126875 | Not Available | 521 | Open in IMG/M |
| 3300010304|Ga0134088_10298325 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300010861|Ga0126349_1028305 | Not Available | 530 | Open in IMG/M |
| 3300011395|Ga0137315_1065788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300011397|Ga0137444_1046264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300011427|Ga0137448_1046369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1090 | Open in IMG/M |
| 3300011436|Ga0137458_1095058 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 851 | Open in IMG/M |
| 3300011442|Ga0137437_1011502 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300011445|Ga0137427_10419481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300012204|Ga0137374_10722460 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012209|Ga0137379_10748329 | Not Available | 882 | Open in IMG/M |
| 3300012210|Ga0137378_11325968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300012226|Ga0137447_1070059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300012350|Ga0137372_10887691 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012358|Ga0137368_10430348 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300013306|Ga0163162_13305171 | Not Available | 516 | Open in IMG/M |
| 3300014871|Ga0180095_1091199 | Not Available | 565 | Open in IMG/M |
| 3300014877|Ga0180074_1026954 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1147 | Open in IMG/M |
| 3300015256|Ga0180073_1044562 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 893 | Open in IMG/M |
| 3300015374|Ga0132255_103832089 | Not Available | 639 | Open in IMG/M |
| 3300017659|Ga0134083_10104229 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300017997|Ga0184610_1326418 | Not Available | 503 | Open in IMG/M |
| 3300018000|Ga0184604_10029811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1377 | Open in IMG/M |
| 3300018056|Ga0184623_10052763 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300018063|Ga0184637_10158125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1397 | Open in IMG/M |
| 3300018072|Ga0184635_10031353 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300018074|Ga0184640_10025703 | Not Available | 2294 | Open in IMG/M |
| 3300018078|Ga0184612_10275375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300018081|Ga0184625_10115093 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300018084|Ga0184629_10423338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300019248|Ga0180117_1398430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → unclassified Campylobacterales → Campylobacterales bacterium | 518 | Open in IMG/M |
| 3300019254|Ga0184641_1037976 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300019254|Ga0184641_1378785 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300019269|Ga0184644_1764088 | Not Available | 685 | Open in IMG/M |
| 3300019279|Ga0184642_1717100 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300019356|Ga0173481_10183286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300019362|Ga0173479_10562379 | Not Available | 589 | Open in IMG/M |
| 3300019789|Ga0137408_1223936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300019881|Ga0193707_1148125 | Not Available | 658 | Open in IMG/M |
| 3300020060|Ga0193717_1001123 | All Organisms → cellular organisms → Bacteria | 16688 | Open in IMG/M |
| 3300020063|Ga0180118_1237437 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1642 | Open in IMG/M |
| 3300020066|Ga0180108_1045913 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
| 3300020186|Ga0163153_10268238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300021081|Ga0210379_10481044 | Not Available | 551 | Open in IMG/M |
| 3300022195|Ga0222625_1684197 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025160|Ga0209109_10207690 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300025904|Ga0207647_10712429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300025920|Ga0207649_10944617 | Not Available | 677 | Open in IMG/M |
| 3300025934|Ga0207686_11716381 | Not Available | 519 | Open in IMG/M |
| 3300026324|Ga0209470_1149320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300026536|Ga0209058_1097941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1492 | Open in IMG/M |
| 3300027722|Ga0209819_10268359 | Not Available | 590 | Open in IMG/M |
| 3300027907|Ga0207428_10732405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300027979|Ga0209705_10313491 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 796 | Open in IMG/M |
| 3300028803|Ga0307281_10252832 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 648 | Open in IMG/M |
| 3300030006|Ga0299907_11037412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300030606|Ga0299906_10159334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1790 | Open in IMG/M |
| 3300030608|Ga0247651_10031251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300030990|Ga0308178_1155042 | Not Available | 529 | Open in IMG/M |
| 3300031170|Ga0307498_10111227 | Not Available | 858 | Open in IMG/M |
| 3300031231|Ga0170824_110351373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 632 | Open in IMG/M |
| 3300031720|Ga0307469_11424713 | Not Available | 661 | Open in IMG/M |
| 3300033414|Ga0316619_11561224 | Not Available | 593 | Open in IMG/M |
| 3300033513|Ga0316628_100969857 | Not Available | 1127 | Open in IMG/M |
| 3300033811|Ga0364924_127329 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300034149|Ga0364929_0013306 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2301 | Open in IMG/M |
| 3300034194|Ga0370499_0124540 | Not Available | 656 | Open in IMG/M |
| 3300034257|Ga0370495_0177268 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 682 | Open in IMG/M |
| 3300034643|Ga0370545_118358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 13.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.35% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 8.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.87% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.93% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.93% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002681 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025154 | Soil microbial communities from Rifle, Colorado, USA - Groundwater F2 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030608 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1009748041 | 3300000559 | Soil | NPITRKKGETDMNNIFYIVGLVVVVLFVAGYFGLR* |
| JGI11643J12802_116084522 | 3300000890 | Soil | RNLITRKKGETDMNNIFYIVGVVVVVIFVAGYLGLR* |
| C687J26615_100312311 | 3300002121 | Soil | ACAFSGSVNPIKRKKGGPKMNNIFYIVGVIVVVLFVAGYLGIR* |
| Ga0005471J37259_1225422 | 3300002681 | Forest Soil | MGIWLHGNPVTSKKGGTDMNNIFYIIGVVVVVLFIAGYLGLR* |
| JGI25382J43887_103354132 | 3300002908 | Grasslands Soil | MLSASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR* |
| Ga0062591_1028002501 | 3300004643 | Soil | GKWVAGSRANPITRKKGETDMNNIFYVVGVIVVVLFVAGYFGLR* |
| Ga0065715_100260835 | 3300005293 | Miscanthus Rhizosphere | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFSQ |
| Ga0070658_114897812 | 3300005327 | Corn Rhizosphere | MLWASSAIVSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0070680_1007885832 | 3300005336 | Corn Rhizosphere | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEF |
| Ga0070675_1000397125 | 3300005354 | Miscanthus Rhizosphere | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFSQV* |
| Ga0070674_1007840851 | 3300005356 | Miscanthus Rhizosphere | MLWASSAIVSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0070667_1013143503 | 3300005367 | Switchgrass Rhizosphere | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFS |
| Ga0070705_1002636172 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFSQD* |
| Ga0070706_1003132112 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAWLTGEPITRKKGASDMNNIIYVIGLGVVVLFVLGYFGLR* |
| Ga0070699_1017444562 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVSTVNRITRKKGEPAMNNIFYIVGVIVVVVFVAGFLGLR* |
| Ga0070672_1003350963 | 3300005543 | Miscanthus Rhizosphere | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0070696_1003036791 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWASGAIVSPITRQKGEIEMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0070704_1011230112 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWASGAIVSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0066698_101451315 | 3300005558 | Soil | ASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR* |
| Ga0068855_1014626441 | 3300005563 | Corn Rhizosphere | SPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0079222_101058422 | 3300006755 | Agricultural Soil | MLWASGALLSPIAGQKGETDMINIFYIIGVVVVVLFIAGYLGLR* |
| Ga0079222_118674571 | 3300006755 | Agricultural Soil | LSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0075431_1007969591 | 3300006847 | Populus Rhizosphere | VLNTQKKGEDDMNNIIYIIGLVVVVLFVLSYFGLR* |
| Ga0079216_100790852 | 3300006918 | Agricultural Soil | MNRTLGPITRKKGETDMNNIFYIVGVIVVVVFVAGYLGLR* |
| Ga0105247_117244351 | 3300009101 | Switchgrass Rhizosphere | MLWASSAILSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR* |
| Ga0114129_111434522 | 3300009147 | Populus Rhizosphere | VRLDVDPIARKKGETDVGNIFYIIGVVVVVLFIAGYFGLR* |
| Ga0114129_129025691 | 3300009147 | Populus Rhizosphere | MGAWLNYDPITRKKGESDMNSIIYLIGLAVVVFFVLGY |
| Ga0105092_109051982 | 3300009157 | Freshwater Sediment | LEQKNRSERVAVWLDGDPIARKKGNTDMNNIFYIIGVVVVVIFIAGYFGLR* |
| Ga0105101_104904621 | 3300009171 | Freshwater Sediment | IVDGPTTPKRGVIDMNIFYIIGVIVVVLFIAGFFGLR* |
| Ga0115596_10490951 | 3300009580 | Wetland | VDGPTTPKKRGLDMNNIFYIIGVIVVVLFIVGYFGFR* |
| Ga0105347_10886121 | 3300009609 | Soil | MGIRLNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR* |
| Ga0105347_13029281 | 3300009609 | Soil | MANQITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR* |
| Ga0105340_11141982 | 3300009610 | Soil | VGNPHTRKKGGPEMNSIIYVVGLVVVVLFVAGYLGLR* |
| Ga0105252_105927031 | 3300009678 | Soil | NPHTRKKGGPEMNSIIYVVGLVVVVLFVAGYLGLR* |
| Ga0105075_10575842 | 3300009799 | Groundwater Sand | MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFIAGYFGFR* |
| Ga0105062_11268751 | 3300009817 | Groundwater Sand | VAVWLDGDPIARKKGNTDMNNIFYIIGVVVVVIFIAGYFGLR* |
| Ga0134088_102983251 | 3300010304 | Grasslands Soil | MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR* |
| Ga0126349_10283051 | 3300010861 | Boreal Forest Soil | VDDPTTLKKGEIDMNNIFYIIGVIVVVLFILGYFGLR* |
| Ga0137315_10657881 | 3300011395 | Soil | LTCLDGDPIARKKGETDMNNVFYIIGVVVVVIFIAGYFGLR* |
| Ga0137444_10462641 | 3300011397 | Soil | SARLKKGGIEMNNIFYIVGLVVVVLFVAGYLGLR* |
| Ga0137448_10463692 | 3300011427 | Soil | MGIRLNGNPFTWKKGETDLHSIFYIVGVVVVVLFVAGLFGLR* |
| Ga0137458_10950581 | 3300011436 | Soil | PITRKKGETDMNSIFYIVGVVVVVIFVAGFFGLR* |
| Ga0137437_10115025 | 3300011442 | Soil | MGIWLNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR* |
| Ga0137427_104194811 | 3300011445 | Soil | LNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR* |
| Ga0137374_107224602 | 3300012204 | Vadose Zone Soil | MLWASDSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR* |
| Ga0137379_107483291 | 3300012209 | Vadose Zone Soil | MLSASGSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR* |
| Ga0137378_113259681 | 3300012210 | Vadose Zone Soil | ASGSTVNSITRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR* |
| Ga0137447_10700591 | 3300012226 | Soil | NPIIRKKGEPDMNSIIYIVGLVVVVLFVAGFLGLR* |
| Ga0137372_108876912 | 3300012350 | Vadose Zone Soil | MLSASGSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR* |
| Ga0137368_104303482 | 3300012358 | Vadose Zone Soil | MLWASDSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR* |
| Ga0163162_133051711 | 3300013306 | Switchgrass Rhizosphere | QQLIDMNPLTRKKGETDMNNIFYIVGVVVVVIFIAGFLGLR* |
| Ga0180095_10911991 | 3300014871 | Soil | MLWASGSTVNPITRRKGETDMNNIFYIVGVVVVVVFVAGYFGLR* |
| Ga0180074_10269543 | 3300014877 | Soil | SLASGSTVNLITQKKGGPKMNNIFYIVGVIVVVLFVAGYLGIR* |
| Ga0180073_10445621 | 3300015256 | Soil | VNPITRKKGGPKMNNIFYIVGVIVVVLFVAGYLGLR* |
| Ga0132255_1038320892 | 3300015374 | Arabidopsis Rhizosphere | LIFEILLWASGSTVNPLTREKGETAMNNIFYIIGVIVVVVFVAGFFGLR* |
| Ga0134083_101042293 | 3300017659 | Grasslands Soil | MLSASGSTVNPITRKKGKTDMNNIFYIVGVVVVVLFVAGYFGLR |
| Ga0184610_13264181 | 3300017997 | Groundwater Sediment | MVNPNTRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR |
| Ga0184604_100298112 | 3300018000 | Groundwater Sediment | MLIDSVNPITRKKGETDMNIFYIVGVIVVVMFVAGFFGLR |
| Ga0184623_100527634 | 3300018056 | Groundwater Sediment | LLNWNPITRKKGGSDMHNIIYIIGLVVVVVFVLKFLGLW |
| Ga0184637_101581253 | 3300018063 | Groundwater Sediment | GSTVNPITRKKGETDMNNIFYIVGVIVVVLFVAGYFGVR |
| Ga0184635_100313531 | 3300018072 | Groundwater Sediment | MGIWLTVNPLTRKKGETAMNNIFYIIGVIVVVVFVAGFFGLR |
| Ga0184640_100257031 | 3300018074 | Groundwater Sediment | RIVLRIRKKGESDMNSIIYLIGLVVVVLFVFSYLGLR |
| Ga0184612_102753751 | 3300018078 | Groundwater Sediment | SGSTVNSITRKKGETDMHNIFYIVGVIVVVLFVAGYFGLR |
| Ga0184625_101150931 | 3300018081 | Groundwater Sediment | MGIWLTVNPLTRKKGETAMINIFYIIGVIVVVVFVAGFFGLR |
| Ga0184629_104233381 | 3300018084 | Groundwater Sediment | MLGASGSTVNPITRKKGESDMNNIFYIVGVVVVVVFVAGYFGLR |
| Ga0180117_13984302 | 3300019248 | Groundwater Sediment | VILWASCSTVNPITRKKGETDMNNIFYIIGVIVVVLFIAGYFGLR |
| Ga0184641_10379763 | 3300019254 | Groundwater Sediment | LVQNPITRKKGETNMNNIFYIVGLVVVVLFVAGYLGLR |
| Ga0184641_13787851 | 3300019254 | Groundwater Sediment | MVNPNTRKKGETGMNNIFYIVGVVVVVLFVAGYLGLR |
| Ga0184644_17640882 | 3300019269 | Groundwater Sediment | SLIVLRIREKGEDDMNNIIYLIGLVVVVLFVLSYFGLR |
| Ga0184642_17171001 | 3300019279 | Groundwater Sediment | RASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR |
| Ga0173481_101832861 | 3300019356 | Soil | MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR |
| Ga0173479_105623791 | 3300019362 | Soil | SGAMLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR |
| Ga0137408_12239361 | 3300019789 | Vadose Zone Soil | MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR |
| Ga0193707_11481251 | 3300019881 | Soil | MLIDSINPLTRKKGETDMNIFYIVGVIVVVMFVAGFFGLR |
| Ga0193717_100112322 | 3300020060 | Soil | FLPKGLASNMLIDSINPLTRKKGETDMNNIFYIVGVVVVVMFIAGFLGLR |
| Ga0180118_12374374 | 3300020063 | Groundwater Sediment | SLASGSTVNLITQKKGGPKMNNIFYIVGVIVVVLFVAGYLGLR |
| Ga0180108_10459132 | 3300020066 | Groundwater Sediment | MLWASGSTVNPITRKKGETDMNNIFYIVGVIVVVVFIAGYLGLR |
| Ga0163153_102682382 | 3300020186 | Freshwater Microbial Mat | MLGASVATVNPLTLKKGETDMNSIFYIVGVVVVVIFVAGFFGLR |
| Ga0210379_104810441 | 3300021081 | Groundwater Sediment | MGIRLNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR |
| Ga0222625_16841971 | 3300022195 | Groundwater Sediment | VNPITRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR |
| Ga0209417_10217532 | 3300025154 | Soil | LKIEDDSIERKKGETDMNNIFYIIGVIVVVLFVLGYFGLR |
| Ga0209109_102076902 | 3300025160 | Soil | MSLATGSTVNPIKRKKGGTDMNNIFYIVGVIVVVLFVAGYLGLR |
| Ga0207647_107124291 | 3300025904 | Corn Rhizosphere | MLWASGAIVSPITRQKGEIEMNNIFYIIGVVVVVLFIAGYLGLR |
| Ga0207649_109446172 | 3300025920 | Corn Rhizosphere | MLWASSAIVSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR |
| Ga0207686_117163811 | 3300025934 | Miscanthus Rhizosphere | MLWASSAILSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR |
| Ga0209470_11493201 | 3300026324 | Soil | SGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR |
| Ga0209058_10979413 | 3300026536 | Soil | MLSASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR |
| Ga0209819_102683591 | 3300027722 | Freshwater Sediment | VAVWLDGDPIARKKGNTDMNNIFYIIGVVVVVIFIAGYFGLR |
| Ga0207428_107324052 | 3300027907 | Populus Rhizosphere | MLWASGAIVSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR |
| Ga0209705_103134912 | 3300027979 | Freshwater Sediment | MLRAFGSTVIPITRKKGGTDMNSIIYVVGLVVVVLFVAGFLGLR |
| Ga0307281_102528322 | 3300028803 | Soil | ASGSTVNPIKRKKGGPKMNNIFYIVGVIVVVLFVAGYLGLG |
| Ga0299907_110374122 | 3300030006 | Soil | MRSWLNSDPITRKKGENDMNNIIYLIGLVVVVLFVLSYFGLR |
| Ga0299906_101593344 | 3300030606 | Soil | MLGASGSTVNPIIRKKGETDMNNIFYIVGVIVVVLFVAGYFGLG |
| Ga0247651_100312512 | 3300030608 | Soil | MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGMR |
| Ga0308178_11550421 | 3300030990 | Soil | IVLRIREKGEDDMNNIIYIIGLVVVVLFVLSYFGLR |
| Ga0307498_101112272 | 3300031170 | Soil | FEILLWASGSTVNPLTRKKGETAMNNIFYIIGVIVVVVFVAGFFGLR |
| Ga0170824_1103513731 | 3300031231 | Forest Soil | ASGSTVNPLTRKKGETAMNNIFYIIGVIVVVVFVAGFFGLR |
| Ga0307469_114247131 | 3300031720 | Hardwood Forest Soil | RLNVDPIARKKGETDMGNIFYIIGVVVVVLFVAGYFGLR |
| Ga0316619_115612241 | 3300033414 | Soil | DPIAQKRGGTDMNNIFYIIGVIVVVLFILGYFGMR |
| Ga0316627_1030290532 | 3300033482 | Soil | NDPTEQKRGGTDMSNIFYIIGVVVVVLFVLGYFGLR |
| Ga0316621_110874051 | 3300033488 | Soil | DPIARKRGEFDMNNIFYIIGVIVVVLFIAGYFGFR |
| Ga0316628_1009698571 | 3300033513 | Soil | MIQSLKKGGTDMNNIFYIIGVIVVVLFILGYFGMR |
| Ga0364924_127329_25_159 | 3300033811 | Sediment | MSWASGSTVNPITRKKGGTDMNNIFYIVRLVVVVLFVAGYFGLR |
| Ga0364929_0013306_475_594 | 3300034149 | Sediment | VRYSTPITRKKGGTDINNIFYIIGVVVVVLFVTGYLGLR |
| Ga0370499_0124540_541_654 | 3300034194 | Untreated Peat Soil | PIAQKTQKKGGTDMNNIFYIIGVIVVVLFILGYFGMR |
| Ga0370495_0177268_15_128 | 3300034257 | Untreated Peat Soil | MVNPSTRKKGETDMNSIFYIVGVVVVVIFVAGFFGLR |
| Ga0370545_118358_221_355 | 3300034643 | Soil | MFGASGPPVNPITRKKGETDMNNIFYIVGVVVVVVFVAGYFGLR |
| ⦗Top⦘ |