


| Basic Information | |
|---|---|
| Family ID | F091804 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.46 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.589 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.822 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.551 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.17% β-sheet: 0.00% Coil/Unstructured: 70.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF12787 | EcsC | 8.41 |
| PF04679 | DNA_ligase_A_C | 7.48 |
| PF05974 | DUF892 | 4.67 |
| PF01068 | DNA_ligase_A_M | 4.67 |
| PF07995 | GSDH | 3.74 |
| PF03401 | TctC | 1.87 |
| PF05532 | CsbD | 1.87 |
| PF09933 | DUF2165 | 1.87 |
| PF01408 | GFO_IDH_MocA | 1.87 |
| PF06823 | DUF1236 | 1.87 |
| PF11752 | DUF3309 | 0.93 |
| PF04343 | DUF488 | 0.93 |
| PF04226 | Transgly_assoc | 0.93 |
| PF11003 | DUF2842 | 0.93 |
| PF03358 | FMN_red | 0.93 |
| PF02738 | MoCoBD_1 | 0.93 |
| PF00590 | TP_methylase | 0.93 |
| PF00723 | Glyco_hydro_15 | 0.93 |
| PF12833 | HTH_18 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 12.15 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 4.67 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 4.67 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 3.74 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.87 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.87 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.93 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.93 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.59 % |
| Unclassified | root | N/A | 8.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig103559 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1026596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1036554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300000956|JGI10216J12902_111897769 | Not Available | 635 | Open in IMG/M |
| 3300005104|Ga0066818_1013802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300005172|Ga0066683_10103150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1732 | Open in IMG/M |
| 3300005178|Ga0066688_10953391 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005332|Ga0066388_100548087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1786 | Open in IMG/M |
| 3300005332|Ga0066388_101056764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1368 | Open in IMG/M |
| 3300005332|Ga0066388_101577773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300005332|Ga0066388_102310428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300005332|Ga0066388_103421995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300005363|Ga0008090_10002269 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300005445|Ga0070708_100637072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300005553|Ga0066695_10175944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1338 | Open in IMG/M |
| 3300005554|Ga0066661_10923054 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005713|Ga0066905_100399296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300005713|Ga0066905_101113869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 702 | Open in IMG/M |
| 3300005764|Ga0066903_105146844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300005764|Ga0066903_106798556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 594 | Open in IMG/M |
| 3300005764|Ga0066903_107721018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300006046|Ga0066652_100879322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300006755|Ga0079222_11907272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300006797|Ga0066659_10018644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3921 | Open in IMG/M |
| 3300006854|Ga0075425_102517866 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006880|Ga0075429_100482473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1086 | Open in IMG/M |
| 3300006914|Ga0075436_100194407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1436 | Open in IMG/M |
| 3300006914|Ga0075436_101005541 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006953|Ga0074063_13032900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 674 | Open in IMG/M |
| 3300007076|Ga0075435_101441100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300009011|Ga0105251_10216215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300009100|Ga0075418_10713763 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300009137|Ga0066709_102955326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
| 3300009137|Ga0066709_103114102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 606 | Open in IMG/M |
| 3300009174|Ga0105241_12607019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300009553|Ga0105249_10272994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1685 | Open in IMG/M |
| 3300010046|Ga0126384_11886611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010048|Ga0126373_10748202 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300010048|Ga0126373_10889420 | Not Available | 954 | Open in IMG/M |
| 3300010333|Ga0134080_10700083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → Acidiferrobacter thiooxydans | 502 | Open in IMG/M |
| 3300010359|Ga0126376_12608863 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010360|Ga0126372_11081020 | Not Available | 819 | Open in IMG/M |
| 3300010361|Ga0126378_12259525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300010362|Ga0126377_11534899 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010362|Ga0126377_13261765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300010366|Ga0126379_10722147 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300010371|Ga0134125_12884901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300010376|Ga0126381_104508301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300010397|Ga0134124_12282893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300010398|Ga0126383_10187370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1973 | Open in IMG/M |
| 3300010398|Ga0126383_13650134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300012022|Ga0120191_10033681 | Not Available | 812 | Open in IMG/M |
| 3300012199|Ga0137383_10859354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. | 662 | Open in IMG/M |
| 3300012207|Ga0137381_11062341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012361|Ga0137360_10407724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300012469|Ga0150984_110668867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300012971|Ga0126369_10181510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2011 | Open in IMG/M |
| 3300014968|Ga0157379_11103959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300015077|Ga0173483_10160366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300015373|Ga0132257_103669786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300016294|Ga0182041_11259011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300016294|Ga0182041_11798823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300016294|Ga0182041_11881496 | Not Available | 556 | Open in IMG/M |
| 3300016371|Ga0182034_11010785 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018034|Ga0187863_10618380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300018051|Ga0184620_10143506 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300018058|Ga0187766_11291156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300019356|Ga0173481_10138595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300021168|Ga0210406_10183546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1742 | Open in IMG/M |
| 3300021168|Ga0210406_10867949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → Acidiferrobacter thiooxydans | 681 | Open in IMG/M |
| 3300021168|Ga0210406_10989268 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021178|Ga0210408_10277742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300021560|Ga0126371_10094278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2967 | Open in IMG/M |
| 3300021560|Ga0126371_10853904 | Not Available | 1055 | Open in IMG/M |
| 3300021560|Ga0126371_13733907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300025909|Ga0207705_10356258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300025910|Ga0207684_10030002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4629 | Open in IMG/M |
| 3300025910|Ga0207684_10308000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1365 | Open in IMG/M |
| 3300025910|Ga0207684_11519254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300025915|Ga0207693_10986638 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300025928|Ga0207700_10077424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2583 | Open in IMG/M |
| 3300026322|Ga0209687_1253771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300026360|Ga0257173_1057692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300026361|Ga0257176_1063744 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026528|Ga0209378_1182568 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300026551|Ga0209648_10212273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1466 | Open in IMG/M |
| 3300027646|Ga0209466_1089301 | Not Available | 623 | Open in IMG/M |
| 3300028536|Ga0137415_10700238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300028778|Ga0307288_10134125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300028809|Ga0247824_10190970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
| 3300028824|Ga0307310_10125293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
| 3300031231|Ga0170824_111532073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031719|Ga0306917_10265575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1318 | Open in IMG/M |
| 3300031744|Ga0306918_11404969 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031748|Ga0318492_10018813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2971 | Open in IMG/M |
| 3300031764|Ga0318535_10095157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1300 | Open in IMG/M |
| 3300031765|Ga0318554_10387686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300031778|Ga0318498_10092913 | Not Available | 1365 | Open in IMG/M |
| 3300031782|Ga0318552_10521513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300031793|Ga0318548_10311291 | Not Available | 774 | Open in IMG/M |
| 3300031799|Ga0318565_10153887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
| 3300031833|Ga0310917_10014546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4400 | Open in IMG/M |
| 3300031835|Ga0318517_10322255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300031897|Ga0318520_10338378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 912 | Open in IMG/M |
| 3300031947|Ga0310909_10507806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300032060|Ga0318505_10147492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1089 | Open in IMG/M |
| 3300032180|Ga0307471_104279182 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_08674890 | 2124908045 | Soil | DVGDAPRHEIEIRGRVERLVVRTFARARDLPERAAGKKVERVAAE |
| AF_2010_repII_A100DRAFT_10265962 | 3300000655 | Forest Soil | PRHEIEIRGRVERLIVRTFARARDLPVLQDGVKXKRARVAAE* |
| AP72_2010_repI_A001DRAFT_10365541 | 3300000893 | Forest Soil | APRHEIEIRGRVERLVVRTFARARDLPVLERGGRKKLARVAAE* |
| JGI10216J12902_1118977691 | 3300000956 | Soil | GRVERLVVRTFASAQDLPITPRGAAKKMAQVPAE* |
| Ga0066818_10138022 | 3300005104 | Soil | LVISEAVMLRAGIDLGAAQRHEIEIRGRVERLVVRTFASARDLPVLESGKRKRA* |
| Ga0066683_101031503 | 3300005172 | Soil | DLGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEVVAAQ* |
| Ga0066688_109533912 | 3300005178 | Soil | APRHEIEIRGRVERLVVRAFASARELPVLQRGTAKRAARVAAE* |
| Ga0066388_1005480873 | 3300005332 | Tropical Forest Soil | APRHEIEIRGRVERLVVRTFARARDLPVLQSGVKKKMARAAAE* |
| Ga0066388_1010567643 | 3300005332 | Tropical Forest Soil | AGIELGDAPRHEIEIRGRVERLVVRTFARARDLPVLERGGRKKRASVAAE* |
| Ga0066388_1015777731 | 3300005332 | Tropical Forest Soil | RHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVQSVAAE* |
| Ga0066388_1023104282 | 3300005332 | Tropical Forest Soil | AGIDLGDAPRHEIEIRGRVERLVVRTFTSARDLPMLERRARRKAASVAAV* |
| Ga0066388_1034219951 | 3300005332 | Tropical Forest Soil | RHEIEIRGRVERLVVRTFASARDLPVVERGGRKKLASVAAE* |
| Ga0008090_100022693 | 3300005363 | Tropical Rainforest Soil | DLGDAPRHEIEIRGRVERLVVRTFARARDLPMPPRGAAKKMERAAAL* |
| Ga0070708_1006370721 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PRHEIEIRGRVERLVVRTFASARDLPVLERRGRKTVASVAAA* |
| Ga0066695_101759442 | 3300005553 | Soil | HEIEIRGRVEGLVVRTFTRARDLPVLGHGALKKVQSVAAE* |
| Ga0066661_109230541 | 3300005554 | Soil | IEIRGRVEGLVVRTFTSARDLPVLGRGALKKVLAAE* |
| Ga0066905_1003992961 | 3300005713 | Tropical Forest Soil | GDAPRHEIEIRGRVERLVVRTFARARDLPELAAAKKVHRVAAE* |
| Ga0066905_1011138691 | 3300005713 | Tropical Forest Soil | APRHEIEIRGRVERLVVRTFERARDLPVPPRGAQKKRERAAAV* |
| Ga0066903_1051468441 | 3300005764 | Tropical Forest Soil | LGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKVEATAAQ* |
| Ga0066903_1067985562 | 3300005764 | Tropical Forest Soil | HEIEIRGRVERLVVRTFTSARDLPMLERRGRKKAASVAAV* |
| Ga0066903_1077210182 | 3300005764 | Tropical Forest Soil | RHEIEIRGRVERLVVRTFASAQDLPITPRGTAKKAERAPAA* |
| Ga0066652_1008793222 | 3300006046 | Soil | RHEIEIRGRVERLVVRTFASARDLPALQRTGAKKVERAAAG* |
| Ga0079222_119072722 | 3300006755 | Agricultural Soil | GRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ* |
| Ga0066659_100186446 | 3300006797 | Soil | GIDLGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEVVAAQ* |
| Ga0075425_1025178661 | 3300006854 | Populus Rhizosphere | RGRVERLVVRTFARARDLPVPPRGAPKKMQRAAAV* |
| Ga0075429_1004824731 | 3300006880 | Populus Rhizosphere | PRHEIEIRGRVERLVVRTFARASDLPERAAAKKVERVTAE* |
| Ga0075436_1001944071 | 3300006914 | Populus Rhizosphere | IEIRGRIERLVVRTFARARDLPVPARGAAKKVERAAAV* |
| Ga0075436_1010055411 | 3300006914 | Populus Rhizosphere | LGDAPSHEIEIRGRVERLVVRTFARARDLPVPPRGAPKKMQRAAAV* |
| Ga0074063_130329002 | 3300006953 | Soil | HEIEIRGRVERLVVRTFTSARDLPVLERERRKRA* |
| Ga0075435_1014411001 | 3300007076 | Populus Rhizosphere | PRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEVVAAQ* |
| Ga0105251_102162152 | 3300009011 | Switchgrass Rhizosphere | RAGIDLGAAPRHEIEIRGRVERLVVRTFATARDLPVLESGKRKRA* |
| Ga0075418_107137632 | 3300009100 | Populus Rhizosphere | APRHEIEIRGRVERLVVRTFARASDLPERAAAKKVERVTAG* |
| Ga0066709_1029553262 | 3300009137 | Grasslands Soil | SDAVALRAGIDLGAAPRHEIEIRGRVERLVVRAFASARDLPVLQHGTAKRAARVAAE* |
| Ga0066709_1031141021 | 3300009137 | Grasslands Soil | SDAVALRAGIDLGAAPRHEIEIRGRVERLVVRAFASARDLPVLQRGTAKRAARVAAE* |
| Ga0105241_126070191 | 3300009174 | Corn Rhizosphere | APRHEIEIRGRVERLVVRTFATARDLPVLEPGKRKRA* |
| Ga0105249_102729943 | 3300009553 | Switchgrass Rhizosphere | GIDLGAAPRHEIEIRGRVERLVVRTFATARDLPVLESGKRKRA* |
| Ga0126384_118866111 | 3300010046 | Tropical Forest Soil | ALRAGIELGDAPRHEIEIRGRVERLVVRTFARARDLPVLERRGRKKLASVAAV* |
| Ga0126373_107482023 | 3300010048 | Tropical Forest Soil | DLGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKVEATAAQ* |
| Ga0126373_108894202 | 3300010048 | Tropical Forest Soil | IEIRGRVERLVVRTFASARDLPVPERRGRKKVERVAAQ* |
| Ga0134080_107000832 | 3300010333 | Grasslands Soil | LGAAPRHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVQSVAAE* |
| Ga0126376_126088631 | 3300010359 | Tropical Forest Soil | IRGRVERLVVRTFARARDLPAPPRGAARKMERTAAL* |
| Ga0126372_110810201 | 3300010360 | Tropical Forest Soil | RHEIEIRGRLERLVVRTFARARDLPILERRGRKKAESVAAV* |
| Ga0126378_122595251 | 3300010361 | Tropical Forest Soil | GDAPRHEIEIRGRVERLVVRTFKSARDLPVLERRGRKKAASVAAV* |
| Ga0126377_115348992 | 3300010362 | Tropical Forest Soil | DAPRHEIEIRGRVERLVVRTFARARDLPVLERRGRKKLASVAAE* |
| Ga0126377_132617652 | 3300010362 | Tropical Forest Soil | ISEAVALGAGIELGDAPRHEIEIRGRVERLVVRTFARARDLPVLERGGRKKRASVAAE* |
| Ga0126379_107221473 | 3300010366 | Tropical Forest Soil | GDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKVEATAAQ* |
| Ga0134125_128849011 | 3300010371 | Terrestrial Soil | APRHEIEIRGRVERLVVRTVATARDLPVLERGRRRERA* |
| Ga0126381_1045083011 | 3300010376 | Tropical Forest Soil | LVISEAVALRAGIDLGDAPSHEIEIRGRVERLVVRTFTSARDLSIPERRGRKKVASVAAV |
| Ga0134124_122828931 | 3300010397 | Terrestrial Soil | AFPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEVVAAQ* |
| Ga0126383_101873703 | 3300010398 | Tropical Forest Soil | GIELGDAPRHEIEIRGRVERLVVRTFARARDLPVLERGGRKKLARVAAE* |
| Ga0126383_136501341 | 3300010398 | Tropical Forest Soil | DAPRHEIEIRGRVERLVVRTFVSARDLPVLERRGRKKVEAAAAQ* |
| Ga0120191_100336813 | 3300012022 | Terrestrial | DLGDAPRHEIEIRGRVERLVVRTFARARDLPERAAAKKVERVAAE* |
| Ga0137383_108593541 | 3300012199 | Vadose Zone Soil | VDLGAAARHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKIQSVTAE* |
| Ga0137381_110623411 | 3300012207 | Vadose Zone Soil | IRGRVERLVVRAFASARELPVLQRGTAKRAARVAAE* |
| Ga0137360_104077242 | 3300012361 | Vadose Zone Soil | GRVERLVVRTFASARDLPVLGRGGLKKVESVAAD* |
| Ga0150984_1106688672 | 3300012469 | Avena Fatua Rhizosphere | APRHEIEIRGRVERLVVRTFATARDLPVPESGKRKRA* |
| Ga0126369_101815103 | 3300012971 | Tropical Forest Soil | LGDAPRHEIEIRGRVERLVVRTFARARDLPAPPRGAARKMERAAAV* |
| Ga0157379_111039592 | 3300014968 | Switchgrass Rhizosphere | APRHEIEIRGRVERLVVRTFASACDLPVPDRAGRKRA* |
| Ga0173483_101603662 | 3300015077 | Soil | DLGAAPRHEIEIRGRVERLVVRTFATARDLPVLERGRRRERA* |
| Ga0132257_1036697861 | 3300015373 | Arabidopsis Rhizosphere | VDLGAAARHEIEIRGRVEGLVVRTLTSARDLPVLGRGGPLKKVQSVAAE* |
| Ga0182041_112590111 | 3300016294 | Soil | VALRAGIELGDAPRHEIEIRGRVERLVVRTFARARDLPVLERRGRKKLASVAAV |
| Ga0182041_117988231 | 3300016294 | Soil | LGDAPRHEIEIRGRVERLVVRTFASARDLPVPERRGRKKAEAVAAQ |
| Ga0182041_118814961 | 3300016294 | Soil | HEIEIRGRVERLVVRTFKSAKDLSLTQRDRAEKAERVAAAQ |
| Ga0182034_110107851 | 3300016371 | Soil | DAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0187863_106183801 | 3300018034 | Peatland | GAAPRHEIEIRGRVERLVVRTFTSARDLPALERTEAKKSRAWSRSAQ |
| Ga0184620_101435061 | 3300018051 | Groundwater Sediment | VMLRAGIDLADAPRHEIEIRGRVERLVVRTFTSARDLPVLERERRKRA |
| Ga0187766_112911561 | 3300018058 | Tropical Peatland | IHLGAAPQHEIEIRGRVERLVVRTFTTAQDLPALNRTGSKKWR |
| Ga0173481_101385952 | 3300019356 | Soil | LRAGIDLGAAPRHEIEIRGRVERLVVRRFATARDLPVLESGKRKRA |
| Ga0210406_101835461 | 3300021168 | Soil | LVISEAVALRAGIDLGDAPSHEIEIRGRVERLVVRTFARARDLPVLPRGAAKKMERAAAV |
| Ga0210406_108679492 | 3300021168 | Soil | RGRVEGLVVRTFTSARDLPVLGRGALKKVQSVAAE |
| Ga0210406_109892682 | 3300021168 | Soil | ALRAGVDLGAAARHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVLAAE |
| Ga0210408_102777423 | 3300021178 | Soil | AGVDLGAAARHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVLAAE |
| Ga0126371_100942783 | 3300021560 | Tropical Forest Soil | APRHEIEIRGRVERLVVRTFARARDLPVLERGGRKKLARVAAE |
| Ga0126371_108539041 | 3300021560 | Tropical Forest Soil | EIEIRGRVERLVVRTFARARDLPVLERRGRKKLASVAAV |
| Ga0126371_137339071 | 3300021560 | Tropical Forest Soil | AGIDLADAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0207705_103562581 | 3300025909 | Corn Rhizosphere | RHEIEIRGRVERLVVRTFASARDLPVLESGKRKRA |
| Ga0207684_100300021 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEVVAAQ |
| Ga0207684_103080004 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DLGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKAESVAAQ |
| Ga0207684_115192541 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | HRSRDAPRHEIEIRGRIERLVVRTFASARDLPVLERRGRRKTESVAAQ |
| Ga0207693_109866381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLGAAARHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVLAAE |
| Ga0207700_100774245 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ISEAVALRAGIDLGDAPSHEIEIRGRVERLVVRTFARARDLPVPPRGAPKKMQRAAAV |
| Ga0209687_12537712 | 3300026322 | Soil | LGAAPRHEIEIRGRVERLVVRAFASARELPVLQRGTAKRAARMAAE |
| Ga0257173_10576922 | 3300026360 | Soil | DLGAAPRHEIEIRGRVERLVVRTFASAQDLPVLSRGGAKKMERVPAE |
| Ga0257176_10637442 | 3300026361 | Soil | LGAAPRHEIEIRGRVEELVVRTFTSARDLPVLGHGALKKVQSVAAE |
| Ga0209378_11825682 | 3300026528 | Soil | SDAVALRAGIDLGAAPRHEIEIRGRVERLVVRAFASARELPVLQRGTAKRAARVAAE |
| Ga0209648_102122731 | 3300026551 | Grasslands Soil | RHEIEIRGRVERLVVRTFASAQDLPVLPRGAAKKMERVPAE |
| Ga0209466_10893012 | 3300027646 | Tropical Forest Soil | IEIRGRVERLVVRTFASARDLPILERRGRKKAESAAAV |
| Ga0137415_107002382 | 3300028536 | Vadose Zone Soil | DLGAAPRHEIEIRGRVERLVVRTFASAQDLPVLSRGAAKKMERVPAA |
| Ga0307288_101341251 | 3300028778 | Soil | GIDLGAAPRHEIEIRGRVERLVVRTFATARDLPVLEPGRRKRA |
| Ga0247824_101909701 | 3300028809 | Soil | AAPRHEIEIRGRVERLVVRTFASARDLPVLESGKRKRA |
| Ga0307310_101252931 | 3300028824 | Soil | GAAPRHEIEIRGRVERLVVRTFATARDLPVLESGKRKRA |
| Ga0170824_1115320731 | 3300031231 | Forest Soil | ALRAGVDLGAAARHEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVQSVAAE |
| Ga0306917_102655754 | 3300031719 | Soil | EIRGRVERLVVRTFASARDLPVLERRGRKKVVTAAAQ |
| Ga0306918_114049692 | 3300031744 | Soil | HEIEIRGRVEGLVVRTFTSARDLPVLGRGALKKVLAAE |
| Ga0318492_100188138 | 3300031748 | Soil | HEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAMAAQ |
| Ga0318535_100951571 | 3300031764 | Soil | IDLGDAPRHEIEIRGRVERLVVRTFTSARDLPMLERRGRKKAASVAAV |
| Ga0318554_103876861 | 3300031765 | Soil | LGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0318498_100929132 | 3300031778 | Soil | GIDVGDAPRHEIEIRGRVERLVVRTFKSAKDLSLTQRDRAEKAERVAAAQ |
| Ga0318552_105215132 | 3300031782 | Soil | IPEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0318548_103112911 | 3300031793 | Soil | EIRGRVERLVVRTFTSARDLPMLERRGRKKAASVAAV |
| Ga0318565_101538872 | 3300031799 | Soil | EIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0310917_100145461 | 3300031833 | Soil | EIEIRGRVERLVVRTFASARDLPVPERRGRKKAEAVAAQ |
| Ga0318517_103222552 | 3300031835 | Soil | EIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0318520_103383782 | 3300031897 | Soil | PEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAVAAQ |
| Ga0310909_105078062 | 3300031947 | Soil | LGDAPRHEIEIRGRVERLVVRTFASARDLPVLERRGRKKTEAMAAQ |
| Ga0318505_101474923 | 3300032060 | Soil | RHEIEIRGRVERLVVRTFASARDLPVLERRGRKKVVTAAAQ |
| Ga0307471_1042791821 | 3300032180 | Hardwood Forest Soil | GAAARHEIEIRGRVEGLVVRTFTSARELPVLGRGALKKVLAAE |
| ⦗Top⦘ |