


| Basic Information | |
|---|---|
| Family ID | F091782 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | KERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGRVAAG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.67 % |
| % of genes near scaffold ends (potentially truncated) | 92.52 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.028 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.234 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.907 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.533 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 8.82% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 9.35 |
| PF00583 | Acetyltransf_1 | 5.61 |
| PF01850 | PIN | 4.67 |
| PF01402 | RHH_1 | 3.74 |
| PF05726 | Pirin_C | 3.74 |
| PF00561 | Abhydrolase_1 | 3.74 |
| PF00903 | Glyoxalase | 2.80 |
| PF13701 | DDE_Tnp_1_4 | 2.80 |
| PF04191 | PEMT | 2.80 |
| PF07969 | Amidohydro_3 | 2.80 |
| PF13356 | Arm-DNA-bind_3 | 1.87 |
| PF13561 | adh_short_C2 | 1.87 |
| PF04140 | ICMT | 1.87 |
| PF12697 | Abhydrolase_6 | 1.87 |
| PF01541 | GIY-YIG | 0.93 |
| PF10415 | FumaraseC_C | 0.93 |
| PF08028 | Acyl-CoA_dh_2 | 0.93 |
| PF00581 | Rhodanese | 0.93 |
| PF02775 | TPP_enzyme_C | 0.93 |
| PF02602 | HEM4 | 0.93 |
| PF00440 | TetR_N | 0.93 |
| PF13545 | HTH_Crp_2 | 0.93 |
| PF01645 | Glu_synthase | 0.93 |
| PF05199 | GMC_oxred_C | 0.93 |
| PF00264 | Tyrosinase | 0.93 |
| PF13517 | FG-GAP_3 | 0.93 |
| PF13361 | UvrD_C | 0.93 |
| PF00144 | Beta-lactamase | 0.93 |
| PF13551 | HTH_29 | 0.93 |
| PF02776 | TPP_enzyme_N | 0.93 |
| PF00691 | OmpA | 0.93 |
| PF08352 | oligo_HPY | 0.93 |
| PF00753 | Lactamase_B | 0.93 |
| PF00441 | Acyl-CoA_dh_1 | 0.93 |
| PF10431 | ClpB_D2-small | 0.93 |
| PF02823 | ATP-synt_DE_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 9.35 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 3.74 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.87 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.93 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.93 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.93 |
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.93 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.03 % |
| Unclassified | root | N/A | 28.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100226173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300004635|Ga0062388_101051270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300005178|Ga0066688_10931138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 534 | Open in IMG/M |
| 3300005434|Ga0070709_10290207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1192 | Open in IMG/M |
| 3300005529|Ga0070741_10626059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300005543|Ga0070672_100956357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300005566|Ga0066693_10030835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1693 | Open in IMG/M |
| 3300005764|Ga0066903_105575423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300006791|Ga0066653_10022791 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300006794|Ga0066658_10579913 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006796|Ga0066665_10305465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1281 | Open in IMG/M |
| 3300006903|Ga0075426_11477723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 517 | Open in IMG/M |
| 3300009137|Ga0066709_103660188 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009143|Ga0099792_10124985 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300009143|Ga0099792_10241886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1047 | Open in IMG/M |
| 3300009156|Ga0111538_10667038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1318 | Open in IMG/M |
| 3300009156|Ga0111538_13444655 | Not Available | 549 | Open in IMG/M |
| 3300010045|Ga0126311_11228238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300010048|Ga0126373_11485911 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010321|Ga0134067_10412636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300010322|Ga0134084_10381509 | Not Available | 545 | Open in IMG/M |
| 3300010325|Ga0134064_10256433 | Not Available | 649 | Open in IMG/M |
| 3300010326|Ga0134065_10381372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 561 | Open in IMG/M |
| 3300010361|Ga0126378_12230077 | Not Available | 625 | Open in IMG/M |
| 3300010366|Ga0126379_12322168 | Not Available | 636 | Open in IMG/M |
| 3300010376|Ga0126381_101782508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300010880|Ga0126350_11262927 | Not Available | 589 | Open in IMG/M |
| 3300011119|Ga0105246_10873160 | Not Available | 804 | Open in IMG/M |
| 3300011269|Ga0137392_10087319 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300011270|Ga0137391_11361924 | Not Available | 556 | Open in IMG/M |
| 3300012096|Ga0137389_11648207 | Not Available | 537 | Open in IMG/M |
| 3300012189|Ga0137388_10172826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1931 | Open in IMG/M |
| 3300012202|Ga0137363_11377958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 595 | Open in IMG/M |
| 3300012208|Ga0137376_11784789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 506 | Open in IMG/M |
| 3300012212|Ga0150985_100722673 | Not Available | 587 | Open in IMG/M |
| 3300012212|Ga0150985_100875919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
| 3300012212|Ga0150985_112226468 | Not Available | 1283 | Open in IMG/M |
| 3300012363|Ga0137390_11452814 | Not Available | 628 | Open in IMG/M |
| 3300012469|Ga0150984_103484766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300012582|Ga0137358_10717731 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012917|Ga0137395_10273404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1192 | Open in IMG/M |
| 3300012917|Ga0137395_10813230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium | 677 | Open in IMG/M |
| 3300012923|Ga0137359_10529423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1038 | Open in IMG/M |
| 3300012971|Ga0126369_10371351 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300014492|Ga0182013_10529180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 610 | Open in IMG/M |
| 3300016294|Ga0182041_11501320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300016422|Ga0182039_11362297 | Not Available | 644 | Open in IMG/M |
| 3300016422|Ga0182039_11740957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300017995|Ga0187816_10244883 | Not Available | 782 | Open in IMG/M |
| 3300018060|Ga0187765_10485190 | Not Available | 779 | Open in IMG/M |
| 3300018088|Ga0187771_10084832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2528 | Open in IMG/M |
| 3300019786|Ga0182025_1221046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2035 | Open in IMG/M |
| 3300020580|Ga0210403_11349491 | Not Available | 542 | Open in IMG/M |
| 3300021401|Ga0210393_11261235 | Not Available | 594 | Open in IMG/M |
| 3300021406|Ga0210386_11511279 | Not Available | 560 | Open in IMG/M |
| 3300021432|Ga0210384_10974442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 749 | Open in IMG/M |
| 3300021479|Ga0210410_10221267 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300025898|Ga0207692_10943076 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300025915|Ga0207693_11060269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300025936|Ga0207670_11472942 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300026316|Ga0209155_1048380 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300026490|Ga0257153_1046119 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300026508|Ga0257161_1135224 | Not Available | 518 | Open in IMG/M |
| 3300026547|Ga0209156_10437845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300027583|Ga0209527_1115652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300027663|Ga0208990_1010803 | All Organisms → cellular organisms → Bacteria | 3043 | Open in IMG/M |
| 3300027905|Ga0209415_10949169 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300027965|Ga0209062_1180220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 791 | Open in IMG/M |
| 3300028781|Ga0302223_10110189 | Not Available | 911 | Open in IMG/M |
| 3300030730|Ga0307482_1215936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 589 | Open in IMG/M |
| 3300030739|Ga0302311_10176833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1638 | Open in IMG/M |
| 3300031525|Ga0302326_12723303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300031545|Ga0318541_10155913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1254 | Open in IMG/M |
| 3300031545|Ga0318541_10658738 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031573|Ga0310915_10885347 | Not Available | 626 | Open in IMG/M |
| 3300031672|Ga0307373_10190049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1496 | Open in IMG/M |
| 3300031708|Ga0310686_111021766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300031719|Ga0306917_10765016 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031719|Ga0306917_11443845 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031724|Ga0318500_10441726 | Not Available | 650 | Open in IMG/M |
| 3300031744|Ga0306918_10155763 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300031744|Ga0306918_10658257 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031770|Ga0318521_10761985 | Not Available | 589 | Open in IMG/M |
| 3300031779|Ga0318566_10578016 | Not Available | 548 | Open in IMG/M |
| 3300031781|Ga0318547_10713451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300031782|Ga0318552_10223381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300031795|Ga0318557_10118408 | Not Available | 1183 | Open in IMG/M |
| 3300031795|Ga0318557_10353162 | Not Available | 676 | Open in IMG/M |
| 3300031798|Ga0318523_10045081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2055 | Open in IMG/M |
| 3300031823|Ga0307478_10107935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2165 | Open in IMG/M |
| 3300031859|Ga0318527_10147851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 984 | Open in IMG/M |
| 3300031880|Ga0318544_10251040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031890|Ga0306925_10227715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2011 | Open in IMG/M |
| 3300031910|Ga0306923_10350037 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300031942|Ga0310916_10796427 | Not Available | 796 | Open in IMG/M |
| 3300031945|Ga0310913_10526753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300031954|Ga0306926_12950064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300032060|Ga0318505_10186831 | Not Available | 968 | Open in IMG/M |
| 3300032060|Ga0318505_10368835 | Not Available | 678 | Open in IMG/M |
| 3300032090|Ga0318518_10478408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300032160|Ga0311301_10834453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1258 | Open in IMG/M |
| 3300032261|Ga0306920_100357904 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
| 3300032261|Ga0306920_100683456 | Not Available | 1513 | Open in IMG/M |
| 3300032770|Ga0335085_12173242 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032955|Ga0335076_11227204 | Not Available | 634 | Open in IMG/M |
| 3300033289|Ga0310914_10212716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
| 3300033290|Ga0318519_10108561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1002261731 | 3300004152 | Bog Forest Soil | ELRDRVAEYAAVGVGHIMVHPHDRNVDDWDSVIEGVGRLAGG* |
| Ga0062388_1010512702 | 3300004635 | Bog Forest Soil | GMMRDRVAAYEAAGVQHVMVHPQDREIDDWDEVIEGVGRLAAG* |
| Ga0066688_109311381 | 3300005178 | Soil | GMMKERVAAYAEAGVRHIMVHPQDREIDDWDTVLDAVGKLAAG* |
| Ga0070709_102902071 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAAG* |
| Ga0070741_106260591 | 3300005529 | Surface Soil | ERVAAYAEAGVQHIMVHPQDREVDDWDAVLEGVGKVAAG* |
| Ga0070672_1009563571 | 3300005543 | Miscanthus Rhizosphere | ERIAAYEAAGVQHVMVHPLDREVDEWDEVIEGVGKAAAG* |
| Ga0066693_100308355 | 3300005566 | Soil | VAAYAEAGVQHIMVHPQDREIDDWDTVLDAVGKLAG* |
| Ga0066903_1055754232 | 3300005764 | Tropical Forest Soil | AAYKAAGVQHVMVHPQDREVDDWDTVIEGIGRVAAG* |
| Ga0066653_100227916 | 3300006791 | Soil | ERIAAYAEAGVQHIMVHPQDREIDNWDTVIEGVGKVAAG* |
| Ga0066658_105799132 | 3300006794 | Soil | MMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKVAAG* |
| Ga0066665_103054651 | 3300006796 | Soil | DVGMMRERVAAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG* |
| Ga0075426_114777232 | 3300006903 | Populus Rhizosphere | GMMRERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAAG* |
| Ga0066709_1036601881 | 3300009137 | Grasslands Soil | MKERVAAYAEAGVQHIMVHPQDREIDDCDTVLEGVGKLAG* |
| Ga0099792_101249851 | 3300009143 | Vadose Zone Soil | ERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKLAAGR* |
| Ga0099792_102418863 | 3300009143 | Vadose Zone Soil | ERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAG* |
| Ga0111538_106670382 | 3300009156 | Populus Rhizosphere | MMKERVAAYEDAGVQHIMVHPQDREVDDWDTVIAGVGKVAAD* |
| Ga0111538_134446552 | 3300009156 | Populus Rhizosphere | VAAYADAGVQHIMVHPQDREVDDWDTVIAGVGKVAAG* |
| Ga0126311_112282381 | 3300010045 | Serpentine Soil | ERIAAYAKAGVQHVMVHPQDREVDDWDTVIEGVGKVAAG* |
| Ga0126373_114859111 | 3300010048 | Tropical Forest Soil | QGELRERLAAYEVAGVQHVMVHPLNRDIDDWDDVIEGVGRVAGRV* |
| Ga0134067_104126361 | 3300010321 | Grasslands Soil | YAEAGVQHIMVHPQDREIDDWDTVLDAVGKLTAG* |
| Ga0134084_103815092 | 3300010322 | Grasslands Soil | VAAYAEAGVQHIMVHPQDREIDDWDTVLDTVGKLAAG* |
| Ga0134064_102564331 | 3300010325 | Grasslands Soil | VAAYAEAGVQHIMVHPQDREIDDWDTVLDAVGKLTAG* |
| Ga0134065_103813722 | 3300010326 | Grasslands Soil | YEAAGVQHVMVHPQDREVDDWDTVIEGVGRVASG* |
| Ga0126378_122300772 | 3300010361 | Tropical Forest Soil | GYANAGVQHVMVHPQDREIDDWDEVIEGVGRLAAG* |
| Ga0126379_123221681 | 3300010366 | Tropical Forest Soil | RDRIAGYANAGVQHVMVHPQDREIDDWDEVIEGVGRLAAG* |
| Ga0126381_1017825081 | 3300010376 | Tropical Forest Soil | GELRDRIAAYAEAGVQHVMVHPLDRDIDDWDAVIEGTGRVAVRLS* |
| Ga0126350_112629272 | 3300010880 | Boreal Forest Soil | VAAYAAAGVQHVMVHPQDREVDEWDTVIEGVGRLVR* |
| Ga0105246_108731602 | 3300011119 | Miscanthus Rhizosphere | AMMKERVAAYAEAGVQHIMVHPQDREVDDWDTVIAGVGKVAAD* |
| Ga0137392_100873195 | 3300011269 | Vadose Zone Soil | RVVAYAEAGVQHVMVHPQDREVDDWDIVIEGVGQVAAA* |
| Ga0137391_113619241 | 3300011270 | Vadose Zone Soil | VGMMKERVAAYAEAGVQHVMVHPQDREVDDWDDVIEGAGKVAAA* |
| Ga0137389_116482071 | 3300012096 | Vadose Zone Soil | KERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGRVAAG* |
| Ga0137388_101728261 | 3300012189 | Vadose Zone Soil | ERVVAYAEAGVQHVMVHPQDREVDDWDIVIEGVGQVAAA* |
| Ga0137363_113779582 | 3300012202 | Vadose Zone Soil | MAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG* |
| Ga0137376_117847891 | 3300012208 | Vadose Zone Soil | AYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLTTG* |
| Ga0150985_1007226732 | 3300012212 | Avena Fatua Rhizosphere | RVAAYREVGVQHIMVHPQDREVDDWDTVIEGVGKVAAAF* |
| Ga0150985_1008759192 | 3300012212 | Avena Fatua Rhizosphere | RVAAYAEAGVQHIMVHPQDREIDDWDTVLEGVGKLAG* |
| Ga0150985_1122264684 | 3300012212 | Avena Fatua Rhizosphere | MMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKVAAA* |
| Ga0137390_114528141 | 3300012363 | Vadose Zone Soil | VAAYAEAGVQHVMVHPQDREDDDWDTVIDGVGKVAGG* |
| Ga0150984_1034847662 | 3300012469 | Avena Fatua Rhizosphere | VGMMKERVAAYAEAGVQHIMVHPQDREVDDCETVIDGVGKIAIG* |
| Ga0137358_107177311 | 3300012582 | Vadose Zone Soil | AYAEAGVQHIMVHPQDREVDDWDTVIEGVGKVAAA* |
| Ga0137395_102734042 | 3300012917 | Vadose Zone Soil | YAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG* |
| Ga0137395_108132302 | 3300012917 | Vadose Zone Soil | MMKERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGKLAAQ* |
| Ga0137359_105294232 | 3300012923 | Vadose Zone Soil | VGMMRERVMAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLTTG* |
| Ga0126369_103713511 | 3300012971 | Tropical Forest Soil | ERVAAYAEAGVQHIMVHPQDREVDDWDTVLAAVGKLAAG* |
| Ga0182013_105291801 | 3300014492 | Bog | DRVAAYAAAGVGHIMVHPHDRNVDDWDSVIEGVGRLAASGA* |
| Ga0182041_115013201 | 3300016294 | Soil | GMMRERIAAYAQAGVQHIMVHPRDREVDDWDAFIESVGRMGAA |
| Ga0182039_113622972 | 3300016422 | Soil | RERVAAYDAAGVQHVMVHPQDREIDDWDRVIEGVGRIAAG |
| Ga0182039_117409571 | 3300016422 | Soil | MLRERVSAYEAAGVQHVMVHPQDREVDDWDTVIEGVGR |
| Ga0187816_102448831 | 3300017995 | Freshwater Sediment | ERVAAYAEAGVQHIMVHPQDREIDDWHTVIEGVGKVAAG |
| Ga0187765_104851901 | 3300018060 | Tropical Peatland | RDEGELRARIAAYAEAGVQHVMVHPLDRDVDDWDAVIEGAGRVAA |
| Ga0187771_100848325 | 3300018088 | Tropical Peatland | KERVAAYEAAGVQHVMVHPQDREVDDWETVIAGVGKLAAG |
| Ga0182025_12210462 | 3300019786 | Permafrost | MMKERVAAYAEAGVQHVMVHPQDREIDDWNTVIEGVGRLL |
| Ga0210403_113494912 | 3300020580 | Soil | RERVAAYEAAGVQHVMVHPQDREIDDWDIVIEGVGKLI |
| Ga0210393_112612351 | 3300021401 | Soil | KDVGMMKERVAAYEAAGVQHVMVHPQDREVDDWDTVISGVGKLI |
| Ga0210386_115112791 | 3300021406 | Soil | VAAYAAAGVQHIMVHPQDREVDDWDTVIAGVGKLI |
| Ga0210384_109744422 | 3300021432 | Soil | RVAAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG |
| Ga0210410_102212674 | 3300021479 | Soil | VAAYATAGVQHVMVHPQDREIDDWDTVIEGVGKLI |
| Ga0207692_109430761 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAAG |
| Ga0207693_110602692 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKERVAAYAGAGVQHIMVHPQDREVDDWDTVIEGVGKLAAG |
| Ga0207670_114729422 | 3300025936 | Switchgrass Rhizosphere | IAAYEAAGVQHVMVHPLDREVDEWDEVIEGVGKAAAG |
| Ga0209155_10483801 | 3300026316 | Soil | KERVAAYVEAGVQHIMVHPQDREIDDWDAVLDAVGKLAG |
| Ga0257153_10461191 | 3300026490 | Soil | MKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKLAVA |
| Ga0257161_11352241 | 3300026508 | Soil | ERVAAYAEAGVQHVMVHPQDREIDDWDTVIEGVGKVAAG |
| Ga0209156_104378451 | 3300026547 | Soil | RERVAAYVEAGVQHIMVHPQDREVDDWDTVLDAVGKLAG |
| Ga0209527_11156522 | 3300027583 | Forest Soil | MMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKLAAA |
| Ga0208990_10108035 | 3300027663 | Forest Soil | VAAYAEAGVQHVMVHPQDREVDDWDTVIEGVGKVAAG |
| Ga0209415_109491692 | 3300027905 | Peatlands Soil | GEMRERVAAYGEAGVQHIMVHPQDREVDDWDTVIEGVGRVAAG |
| Ga0209062_11802202 | 3300027965 | Surface Soil | KERVAAYAEAGVQHIMVHPQDREVDDWDAVLEGVGKVAAG |
| Ga0302223_101101891 | 3300028781 | Palsa | DRVAAYAAIGVGHIMIHPHDRNVDDWDSVIEGVGRLAGG |
| Ga0307482_12159362 | 3300030730 | Hardwood Forest Soil | MMRDRVAAYKGAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG |
| Ga0302311_101768332 | 3300030739 | Palsa | RVAAYSAIGVGHIMIHPHDRNVDDWDSVIEGVGRLAGG |
| Ga0302326_127233032 | 3300031525 | Palsa | PGMMQERVAAYKEAGVQHIMVHPQDREVDDWNTVIEAVGRLAAG |
| Ga0318541_101559133 | 3300031545 | Soil | MRNRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVATA |
| Ga0318541_106587381 | 3300031545 | Soil | MRERVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVARD |
| Ga0310915_108853471 | 3300031573 | Soil | DRLAEFAAAGVQHVMVHPLNRDIDDWDEVIEGVGRVASRT |
| Ga0307373_101900494 | 3300031672 | Soil | AFAEIGVQHIMVHPQDREVDDWDTVIAGVGKLAAG |
| Ga0310686_1110217662 | 3300031708 | Soil | GELRERIAAYAEAGVQHVMVHPLDRDIDDWDAVIEGTGRVAA |
| Ga0306917_107650161 | 3300031719 | Soil | AAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVARD |
| Ga0306917_114438451 | 3300031719 | Soil | AAYEAVGVQHVMVHPHDREVDDWDTVIEGVGRVAAYM |
| Ga0318500_104417262 | 3300031724 | Soil | RDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRLLH |
| Ga0306918_101557631 | 3300031744 | Soil | VGMMRDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVVAS |
| Ga0306918_106582572 | 3300031744 | Soil | VGMMRERVAAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLARG |
| Ga0318521_107619852 | 3300031770 | Soil | MRERVAAYDAAGVQHVMVHPQDREIDDWDRVIEGVGRIAAG |
| Ga0318566_105780161 | 3300031779 | Soil | GMMRNRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVATS |
| Ga0318547_107134511 | 3300031781 | Soil | AYEAAGVQHVMVHPQDREVDDWDEVIEGVGRLATG |
| Ga0318552_102233812 | 3300031782 | Soil | GMMRDRVAAYEAAGVQHVMVHPQDREVDDWDEVIEGVGRLATG |
| Ga0318557_101184082 | 3300031795 | Soil | DIGMMRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRLLH |
| Ga0318557_103531622 | 3300031795 | Soil | SAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG |
| Ga0318523_100450814 | 3300031798 | Soil | VAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVATA |
| Ga0307478_101079352 | 3300031823 | Hardwood Forest Soil | MMRDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVATGY |
| Ga0318527_101478513 | 3300031859 | Soil | AAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRIAAG |
| Ga0318544_102510401 | 3300031880 | Soil | MMRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRLANT |
| Ga0306925_102277151 | 3300031890 | Soil | GMMRERVAAYEAVGVQHVMVHPQDREIDDWDTVIEGAGRVANA |
| Ga0306923_103500371 | 3300031910 | Soil | DRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVVAS |
| Ga0310916_107964273 | 3300031942 | Soil | MMRERVAAYEAAGVQHVMVHPHDREVDDWDTVIEGVGRVASG |
| Ga0310913_105267531 | 3300031945 | Soil | ERVAAYEAVGVQHVMVHPQDREIDDWDTVIEGAGRVANA |
| Ga0306926_129500642 | 3300031954 | Soil | VGMMRDRIAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG |
| Ga0318505_101868312 | 3300032060 | Soil | DVGMLRERVSAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG |
| Ga0318505_103688352 | 3300032060 | Soil | MRDRVAAYKAAGVQHVMVHPQDREVDDWDSVIEGVGRVATG |
| Ga0318518_104784082 | 3300032090 | Soil | GELRDRLGGYAAIGVQHVMVHPVDRDIDDWDAVIEGTGRVAARSPSLAAGRSP |
| Ga0311301_108344533 | 3300032160 | Peatlands Soil | MMKERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGKVAAG |
| Ga0306920_1003579041 | 3300032261 | Soil | ARIAAYGEAGVQHVMIHPVDRNVDDWDAVIEGTGRVAN |
| Ga0306920_1006834561 | 3300032261 | Soil | DVGMMRDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVVAS |
| Ga0335085_121732422 | 3300032770 | Soil | VGMMQERVAAYAEAGVQHIMVHPQDREVDDWDTVLDGVGKVSGASKM |
| Ga0335076_112272042 | 3300032955 | Soil | AAYAEAGVQHVMVHPLNRDIDDWDAVIDGAGRVAA |
| Ga0310914_102127164 | 3300033289 | Soil | ELRERLAAYEVVVQHVMVHPLNRDIDDWNEVIEGLGRVAARI |
| Ga0318519_101085613 | 3300033290 | Soil | GMMRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGCLAVG |
| ⦗Top⦘ |