


| Basic Information | |
|---|---|
| Family ID | F091743 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSF |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.72 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 81.31 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.430 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.925 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.402 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07478 | Dala_Dala_lig_C | 77.57 |
| PF00571 | CBS | 14.02 |
| PF06144 | DNA_pol3_delta | 1.87 |
| PF03544 | TonB_C | 0.93 |
| PF05190 | MutS_IV | 0.93 |
| PF05192 | MutS_III | 0.93 |
| PF00488 | MutS_V | 0.93 |
| PF14681 | UPRTase | 0.93 |
| PF05036 | SPOR | 0.93 |
| PF05258 | DciA | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 2.80 |
| COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 1.87 |
| COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 1.87 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.93 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_119040746 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300002562|JGI25382J37095_10136653 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300002916|JGI25389J43894_1103101 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300004480|Ga0062592_100515571 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005166|Ga0066674_10024111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2652 | Open in IMG/M |
| 3300005179|Ga0066684_10140523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1523 | Open in IMG/M |
| 3300005440|Ga0070705_100563789 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005444|Ga0070694_100385635 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300005454|Ga0066687_10664035 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005553|Ga0066695_10000120 | All Organisms → cellular organisms → Bacteria | 17100 | Open in IMG/M |
| 3300005558|Ga0066698_10510332 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005568|Ga0066703_10000066 | All Organisms → cellular organisms → Bacteria | 20496 | Open in IMG/M |
| 3300005578|Ga0068854_100669450 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005586|Ga0066691_10011567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4132 | Open in IMG/M |
| 3300005598|Ga0066706_10082664 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300005598|Ga0066706_10146642 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300005879|Ga0075295_1024189 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006046|Ga0066652_101265862 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006794|Ga0066658_10111783 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300006797|Ga0066659_10002761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8208 | Open in IMG/M |
| 3300006797|Ga0066659_10603953 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300006797|Ga0066659_11516493 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006844|Ga0075428_100940749 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300006846|Ga0075430_100472970 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300006847|Ga0075431_101341141 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300006904|Ga0075424_101678616 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300006914|Ga0075436_100025480 | All Organisms → cellular organisms → Bacteria | 4071 | Open in IMG/M |
| 3300006914|Ga0075436_100607632 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300007258|Ga0099793_10002806 | All Organisms → cellular organisms → Bacteria | 5904 | Open in IMG/M |
| 3300007764|Ga0102950_1209867 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009038|Ga0099829_11613989 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009089|Ga0099828_10870288 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300009089|Ga0099828_11398702 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009090|Ga0099827_10015465 | All Organisms → cellular organisms → Bacteria | 5123 | Open in IMG/M |
| 3300009090|Ga0099827_11277521 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009098|Ga0105245_11171743 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300010134|Ga0127484_1164138 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010301|Ga0134070_10020310 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300010304|Ga0134088_10047086 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300010304|Ga0134088_10056402 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300010373|Ga0134128_10434466 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300011438|Ga0137451_1014695 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300011438|Ga0137451_1080078 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300012035|Ga0137445_1094869 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012140|Ga0137351_1016433 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012160|Ga0137349_1017421 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300012202|Ga0137363_10198998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1606 | Open in IMG/M |
| 3300012206|Ga0137380_10283920 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300012211|Ga0137377_10560866 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1080 | Open in IMG/M |
| 3300012211|Ga0137377_11774189 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012349|Ga0137387_10109201 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300012349|Ga0137387_11057408 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012351|Ga0137386_10593037 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300012354|Ga0137366_10622817 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012361|Ga0137360_10872092 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012383|Ga0134033_1137596 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012386|Ga0134046_1266182 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012392|Ga0134043_1239058 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012402|Ga0134059_1036252 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012683|Ga0137398_10265275 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300012930|Ga0137407_10246947 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300012976|Ga0134076_10382437 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012976|Ga0134076_10534123 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300014154|Ga0134075_10034910 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300015054|Ga0137420_1281538 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300015200|Ga0173480_11106768 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300015245|Ga0137409_10091336 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300015359|Ga0134085_10058365 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300017654|Ga0134069_1327824 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300017657|Ga0134074_1092950 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300017657|Ga0134074_1311184 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017659|Ga0134083_10113096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1078 | Open in IMG/M |
| 3300018077|Ga0184633_10303196 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300018078|Ga0184612_10524542 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300018433|Ga0066667_10927726 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300018468|Ga0066662_10026490 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
| 3300018468|Ga0066662_10495726 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300018482|Ga0066669_10117116 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300019869|Ga0193705_1073756 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300020059|Ga0193745_1135375 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300021046|Ga0215015_10484690 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021086|Ga0179596_10659773 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021363|Ga0193699_10030454 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300021418|Ga0193695_1008640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 1997 | Open in IMG/M |
| 3300022532|Ga0242655_10301908 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300024325|Ga0247678_1050017 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300025885|Ga0207653_10107461 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300025885|Ga0207653_10227396 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300026298|Ga0209236_1020106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3741 | Open in IMG/M |
| 3300026313|Ga0209761_1002398 | All Organisms → cellular organisms → Bacteria | 12318 | Open in IMG/M |
| 3300026318|Ga0209471_1190450 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300026327|Ga0209266_1091728 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300026332|Ga0209803_1030364 | All Organisms → cellular organisms → Bacteria | 2563 | Open in IMG/M |
| 3300026532|Ga0209160_1185148 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300026540|Ga0209376_1214324 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300026542|Ga0209805_1178385 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300026548|Ga0209161_10189708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1150 | Open in IMG/M |
| 3300026550|Ga0209474_10604053 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027748|Ga0209689_1349073 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027862|Ga0209701_10025303 | All Organisms → cellular organisms → Bacteria | 3860 | Open in IMG/M |
| 3300027903|Ga0209488_11236532 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028536|Ga0137415_11415150 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031421|Ga0308194_10316106 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031720|Ga0307469_10864547 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300032180|Ga0307471_101652738 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300033417|Ga0214471_10135476 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300034178|Ga0364934_0242829 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012140 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1190407461 | 3300000956 | Soil | MGPQRMYGLTTWVRRLLVANLLVFLVQNTLFTDATLTNAFAF |
| JGI25382J37095_101366532 | 3300002562 | Grasslands Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGF |
| JGI25389J43894_11031011 | 3300002916 | Grasslands Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFSPA |
| Ga0062592_1005155712 | 3300004480 | Soil | MTWRPEGEMGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVAA |
| Ga0066674_100241113 | 3300005166 | Soil | MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSFAGAFGFSP |
| Ga0066684_101405231 | 3300005179 | Soil | MGPQRMYGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFGFAP |
| Ga0070705_1005637891 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPQRMYGLTIWVRRLLVVNLLVFLIQSTLLTSPSFAGAF |
| Ga0070694_1003856352 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPQRMYSLTLWVRRLLVANLLVFLIQKTLLIDPKYVAAFGFDPLQA |
| Ga0066687_106640351 | 3300005454 | Soil | MGPQRMYGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFGFAPLLAWKQ |
| Ga0066695_1000012020 | 3300005553 | Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQ |
| Ga0066698_105103322 | 3300005558 | Soil | MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSFAGAFGFS |
| Ga0066703_1000006621 | 3300005568 | Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFS |
| Ga0068854_1006694501 | 3300005578 | Corn Rhizosphere | MGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKY |
| Ga0066691_100115671 | 3300005586 | Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRT |
| Ga0066706_100826641 | 3300005598 | Soil | MGPHRMFGMTPWVRRLMVANLVVFLFQVTLFVSPAFLTTLQ |
| Ga0066706_101466421 | 3300005598 | Soil | MGPQRMYGLTTWVRRLLVANLLVFLIQNTLFVDSNFIKAFAF |
| Ga0075295_10241892 | 3300005879 | Rice Paddy Soil | MTPQRTFGMTPWVFRLLVANLLVYLLQVTVFVDPK |
| Ga0066652_1012658622 | 3300006046 | Soil | MGPQRMYGLTLWVRRLLVANLLVFLIQKTVLIDPRYLEALGLVPLHALER |
| Ga0066658_101117833 | 3300006794 | Soil | MDPQRMFGMTPWVRRLVVANLVVFLLQVTLFVSPGFLA |
| Ga0066659_100027619 | 3300006797 | Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVD |
| Ga0066659_106039531 | 3300006797 | Soil | MGPQRMYGLSPWVRRLLVANLLVFLVQNTLFATNPDF |
| Ga0066659_115164932 | 3300006797 | Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQNTLFVDGTLTKALAFAPLDAWKQRSPQAR* |
| Ga0075428_1009407492 | 3300006844 | Populus Rhizosphere | MGPQRMYVLTPWVRRLLVANLIVFLFQVTLFTLQSSANMFGFIPLLAAQR |
| Ga0075430_1004729701 | 3300006846 | Populus Rhizosphere | MMTEDLLGPPRMYTLTPWVRRLLVANLIVFLFQATLFT |
| Ga0075431_1013411411 | 3300006847 | Populus Rhizosphere | MMTEDTLGPQRMYVLTPWVRRLLVANLIVFLFQVTLLTL |
| Ga0075424_1016786162 | 3300006904 | Populus Rhizosphere | MMTEDLMGPPRMYALTPWVRRLLVANLIVFLFQVTLFTLQ |
| Ga0075436_1000254805 | 3300006914 | Populus Rhizosphere | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFSPAHA |
| Ga0075436_1006076322 | 3300006914 | Populus Rhizosphere | MMTEDLMGPPRMYVLTPWVRRLLVANLIVFLFQVT |
| Ga0099793_100028061 | 3300007258 | Vadose Zone Soil | MGPQRMYSLTLWVRRLLVANLLVFLIQKTLLVDPSFLSAFGFDP |
| Ga0102950_12098672 | 3300007764 | Soil | MFGMTTWVRRLLVANLLVFLLQLTIFAGPRFIAAFGLDPLQAA |
| Ga0099829_116139891 | 3300009038 | Vadose Zone Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFSP |
| Ga0099828_108702881 | 3300009089 | Vadose Zone Soil | MGPQRMFGMTPWVRRLIVANLIVFLLQMTIFVNPWFV |
| Ga0099828_113987022 | 3300009089 | Vadose Zone Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFRFSPA |
| Ga0099827_100154651 | 3300009090 | Vadose Zone Soil | MGPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFIGTL |
| Ga0099827_112775212 | 3300009090 | Vadose Zone Soil | MTEDLMGPPRMYGLTPWVRRLLVANLIVFLFQATLF |
| Ga0105245_111717432 | 3300009098 | Miscanthus Rhizosphere | MGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVA |
| Ga0127484_11641382 | 3300010134 | Grasslands Soil | MGPQRLYGLTLWVRRLLVANLLVFLVQSTLLTSPSFRVALGFNPMHAWEQ |
| Ga0134070_100203101 | 3300010301 | Grasslands Soil | MGPQRIFGMTPWVRRLFVANLVVFLFQMTIFVDPRFLATFG |
| Ga0134088_100470863 | 3300010304 | Grasslands Soil | MGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFGFT |
| Ga0134088_100564023 | 3300010304 | Grasslands Soil | MGTQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFGFT |
| Ga0134128_104344661 | 3300010373 | Terrestrial Soil | MFGMTPWVRRLLVANLLVFLLQETVFLKAAQFLAFDPLHA |
| Ga0137451_10146951 | 3300011438 | Soil | MEDAPRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQAVFGFEPLLAVA |
| Ga0137451_10800782 | 3300011438 | Soil | MMTEDLLGPPRMYALTPWVRRLLVANLIVFLFQATLFTSRAFTDTFGFV |
| Ga0137445_10948692 | 3300012035 | Soil | MEDAPRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQAIFGFEPLFAAAR |
| Ga0137351_10164332 | 3300012140 | Soil | MGPQRMYSLTVWVRRILVANLLVFLIQKTLLVDPKY |
| Ga0137349_10174212 | 3300012160 | Soil | MEDAPRMFGMTPRVRRLLVANLLVFLCQKTVLVDPRFQAIFGF* |
| Ga0137363_101989983 | 3300012202 | Vadose Zone Soil | MGPQRMYGLTVWVRRLLVANLLVFLIQSTLLTSPSFADDFG |
| Ga0137380_102839203 | 3300012206 | Vadose Zone Soil | MDSQRMFGMTPWVRRLLVANLLVFLCQQTVLVDPRFQALFGFQPLYALERP |
| Ga0137377_105608661 | 3300012211 | Vadose Zone Soil | MDPQRMFGMTPWVRRLVVANLVVFLLQVTLFVSPGFLATFG |
| Ga0137377_117741892 | 3300012211 | Vadose Zone Soil | MDSQRMFGMTTWVRRLLVANLLVFLCQKTVLVDPRFQAVFGF |
| Ga0137387_101092011 | 3300012349 | Vadose Zone Soil | MMTEDLMGPPRMYVLTPWVRRLLVANLIVFLFQVTLFTLQGSANTFGFI |
| Ga0137387_110574082 | 3300012349 | Vadose Zone Soil | MFGLSLWVRRLLVANLLVFLIQKTLLVDPSFLNAF |
| Ga0137386_105930371 | 3300012351 | Vadose Zone Soil | MGPQRMFGMTPWVRRLMVACLFVFLLQSTLFTSPPFIRQFG |
| Ga0137366_106228172 | 3300012354 | Vadose Zone Soil | MDTQRVFGMTPWVRRLFAANLLVFVLQETVLGPRFLAAFGFAPLK |
| Ga0137360_108720921 | 3300012361 | Vadose Zone Soil | MGPQRMYGLTVWVRRLLVANLLVFLIQSTLLTSPSFADAF |
| Ga0134033_11375961 | 3300012383 | Grasslands Soil | MGPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFIGTLGLTPLY |
| Ga0134046_12661821 | 3300012386 | Grasslands Soil | MDPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFV |
| Ga0134043_12390581 | 3300012392 | Grasslands Soil | MGPQRLYGLTLWVRRLLVANLLVFLVQSTLLTSPSFRVALG |
| Ga0134059_10362521 | 3300012402 | Grasslands Soil | MFGLSLWVRRLLVANLLVFLIQKTLLVDPNSLKAFGFAPLLAWKQ |
| Ga0137398_102652752 | 3300012683 | Vadose Zone Soil | MYGLTPWVRRLLVANLLVFLIQNTLLTSASFADAFAFA |
| Ga0137407_102469471 | 3300012930 | Vadose Zone Soil | MGPQRMFGMTPWVRRLMVACLFVFLLQSTLFTSSAFVQQFG |
| Ga0134076_103824371 | 3300012976 | Grasslands Soil | MGPQRLFGMTPWVRRLIVANLVVFLLQVTLFVNPAFLATL |
| Ga0134076_105341231 | 3300012976 | Grasslands Soil | MNEDLMGPPRMYGFTPWVRRLLVANLIVFLFQVTLFTLQSSANTFGFI |
| Ga0134075_100349101 | 3300014154 | Grasslands Soil | MGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVF |
| Ga0137420_12815381 | 3300015054 | Vadose Zone Soil | MNEDLMGPPRMYGFTPWVRRLLVANLIVFLFQVTLFTLQSSANTFGFIPLLAA |
| Ga0173480_111067682 | 3300015200 | Soil | MGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVAAFGFD |
| Ga0137409_100913361 | 3300015245 | Vadose Zone Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQNTLFVDGTLTKALAFAPVDAWKQ |
| Ga0134085_100583651 | 3300015359 | Grasslands Soil | MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSF |
| Ga0134069_13278242 | 3300017654 | Grasslands Soil | MDPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFIG |
| Ga0134074_10929501 | 3300017657 | Grasslands Soil | MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSFVGAFGFS |
| Ga0134074_13111841 | 3300017657 | Grasslands Soil | MGPQRMYGLTPWVRRLLVANLLVFLLQVTLFTSPGFVKA |
| Ga0134083_101130961 | 3300017659 | Grasslands Soil | MEAQRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQ |
| Ga0184633_103031962 | 3300018077 | Groundwater Sediment | MDPQRMFGMTPWVRRLLVANLLVFLCQQTVLVDPRFQAVFGFQPLF |
| Ga0184612_105245421 | 3300018078 | Groundwater Sediment | MMTEDLMGPPRMYVLTPWVRRLLVANLIVFLFQVTLFT |
| Ga0066667_109277262 | 3300018433 | Grasslands Soil | VMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQ |
| Ga0066662_100264905 | 3300018468 | Grasslands Soil | VGDDLALGPPRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFGFTP |
| Ga0066662_104957261 | 3300018468 | Grasslands Soil | VMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQA |
| Ga0066669_101171161 | 3300018482 | Grasslands Soil | MGPQRMFGMTPWVRRLFVANLVVFLFQMTIFVDPR |
| Ga0193705_10737561 | 3300019869 | Soil | MMTEDTLGPQRMYVLTPWVRRLLVANLIVFLFQVTLLTLQGSIET |
| Ga0193745_11353752 | 3300020059 | Soil | MDPQRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQ |
| Ga0215015_104846901 | 3300021046 | Soil | MGPQRMFGMTPWVGRLIVANLIVFLLQMTIFVNPWFVATFGFTPLDA |
| Ga0179596_106597731 | 3300021086 | Vadose Zone Soil | MDSQRMFGMTTWVRRLLVANLLVFLCQKTVLVDPRFQA |
| Ga0193699_100304543 | 3300021363 | Soil | MDPQRMFGMTPWVRRLLVANLVVFLCQKTVLVDPR |
| Ga0193695_10086401 | 3300021418 | Soil | MGPQRMYGLSPWVRRLLVANLLVFLVQNTLFATNPDFAKAFAFSPLVAWNQP |
| Ga0242655_103019082 | 3300022532 | Soil | MDPQRVFGTTPWVRRLLVACLLVFLCQKTVLVDPRFQALFGFQPYYALSR |
| Ga0247678_10500172 | 3300024325 | Soil | MGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVAAFAFDPMLAW |
| Ga0207653_101074612 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPQRMYGLTPWVRRLLVANLLVFLVQNTLFATNPDFATLFPFNPMLA |
| Ga0207653_102273961 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPQRMYGLTLWVRRLLVANLLVFLVQSTLFTSPSFLKALGFDPMSASR |
| Ga0209236_10201061 | 3300026298 | Grasslands Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDP |
| Ga0209761_10023981 | 3300026313 | Grasslands Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLF |
| Ga0209471_11904502 | 3300026318 | Soil | MGPQRMYGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFG |
| Ga0209266_10917281 | 3300026327 | Soil | MDTPRVFGMTPWVRRLFAANLLVFVLQETVLGPRFLAAFGFAPMK |
| Ga0209803_10303641 | 3300026332 | Soil | MGPQRTFGMTPWVRRLMVANLVVFLLQETIFVSPRFIATF |
| Ga0209160_11851482 | 3300026532 | Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQA |
| Ga0209376_12143242 | 3300026540 | Soil | MDPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGF |
| Ga0209805_11783852 | 3300026542 | Soil | MGPQRLFGMTPWVRRLIVANLVVFLLQVTLFVNPAFLATLG |
| Ga0209161_101897081 | 3300026548 | Soil | VMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDP |
| Ga0209474_106040532 | 3300026550 | Soil | MGPQRMYGLTLWVRRLLVANLLVFLIQKTVLIDPSYLRA |
| Ga0209689_13490731 | 3300027748 | Soil | MGPQRMFGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFGFAPL |
| Ga0209701_100253031 | 3300027862 | Vadose Zone Soil | VGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFG |
| Ga0209488_112365321 | 3300027903 | Vadose Zone Soil | MGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSF |
| Ga0137415_114151502 | 3300028536 | Vadose Zone Soil | MGPQRMYGLTLWVRRLLVANLLVFLVQNTLFATNPDFAKAFAFTPLTAW |
| Ga0308194_103161062 | 3300031421 | Soil | MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSASFADALAFV |
| Ga0307469_108645471 | 3300031720 | Hardwood Forest Soil | MDPQRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQAVFG |
| Ga0307471_1016527381 | 3300032180 | Hardwood Forest Soil | MGPQRMFGMTPWVWRLIVANLVVFLLQVTLFVSPAFLATF |
| Ga0214471_101354761 | 3300033417 | Soil | MGPQRMYGLTLWVRRLLVANLLVFLIQSTLLTDPGFLKAFGF |
| Ga0364934_0242829_1_105 | 3300034178 | Sediment | MMTEDLLGPPRMYALTPWVRRLLVANLIVFRFQAT |
| ⦗Top⦘ |