


| Basic Information | |
|---|---|
| Family ID | F091739 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 29.91 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 61.68 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.374 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (41.121 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01416 | PseudoU_synth_1 | 2.80 |
| PF02604 | PhdYeFM_antitox | 1.87 |
| PF13578 | Methyltransf_24 | 1.87 |
| PF01258 | zf-dskA_traR | 1.87 |
| PF07676 | PD40 | 1.87 |
| PF08241 | Methyltransf_11 | 1.87 |
| PF00202 | Aminotran_3 | 1.87 |
| PF01797 | Y1_Tnp | 1.87 |
| PF01370 | Epimerase | 1.87 |
| PF00106 | adh_short | 0.93 |
| PF04030 | ALO | 0.93 |
| PF04041 | Glyco_hydro_130 | 0.93 |
| PF01642 | MM_CoA_mutase | 0.93 |
| PF00196 | GerE | 0.93 |
| PF00149 | Metallophos | 0.93 |
| PF05690 | ThiG | 0.93 |
| PF12696 | TraG-D_C | 0.93 |
| PF13426 | PAS_9 | 0.93 |
| PF16757 | Fucosidase_C | 0.93 |
| PF00708 | Acylphosphatase | 0.93 |
| PF14417 | MEDS | 0.93 |
| PF00108 | Thiolase_N | 0.93 |
| PF10101 | DUF2339 | 0.93 |
| PF01636 | APH | 0.93 |
| PF00156 | Pribosyltran | 0.93 |
| PF02771 | Acyl-CoA_dh_N | 0.93 |
| PF00027 | cNMP_binding | 0.93 |
| PF16363 | GDP_Man_Dehyd | 0.93 |
| PF00486 | Trans_reg_C | 0.93 |
| PF00011 | HSP20 | 0.93 |
| PF03544 | TonB_C | 0.93 |
| PF10102 | DUF2341 | 0.93 |
| PF03819 | MazG | 0.93 |
| PF02628 | COX15-CtaA | 0.93 |
| PF01740 | STAS | 0.93 |
| PF00872 | Transposase_mut | 0.93 |
| PF14279 | HNH_5 | 0.93 |
| PF06068 | TIP49 | 0.93 |
| PF00589 | Phage_integrase | 0.93 |
| PF02682 | CT_C_D | 0.93 |
| PF05167 | DUF711 | 0.93 |
| PF01926 | MMR_HSR1 | 0.93 |
| PF00248 | Aldo_ket_red | 0.93 |
| PF00580 | UvrD-helicase | 0.93 |
| PF06580 | His_kinase | 0.93 |
| PF04305 | DUF455 | 0.93 |
| PF13546 | DDE_5 | 0.93 |
| PF13394 | Fer4_14 | 0.93 |
| PF01128 | IspD | 0.93 |
| PF14534 | DUF4440 | 0.93 |
| PF02310 | B12-binding | 0.93 |
| PF13683 | rve_3 | 0.93 |
| PF01709 | Transcrip_reg | 0.93 |
| PF12838 | Fer4_7 | 0.93 |
| PF07470 | Glyco_hydro_88 | 0.93 |
| PF13502 | AsmA_2 | 0.93 |
| PF12704 | MacB_PCD | 0.93 |
| PF00291 | PALP | 0.93 |
| PF13366 | PDDEXK_3 | 0.93 |
| PF08530 | PepX_C | 0.93 |
| PF13524 | Glyco_trans_1_2 | 0.93 |
| PF08282 | Hydrolase_3 | 0.93 |
| PF01351 | RNase_HII | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 2.80 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.87 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.87 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.87 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.87 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.93 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.93 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.93 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.93 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.93 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.93 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.93 |
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.93 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.93 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.93 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.93 |
| COG1224 | DNA helicase TIP49, TBP-interacting protein | Transcription [K] | 0.93 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.93 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.93 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.93 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.93 |
| COG2049 | 5-oxoprolinase subunit B/Allophanate hydrolase subunit 1 | Amino acid transport and metabolism [E] | 0.93 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.93 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.93 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2833 | Uncharacterized protein, contains ferritin-like DUF455 domain | Function unknown [S] | 0.93 |
| COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.93 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.93 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.93 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.93 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.93 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.37 % |
| Unclassified | root | N/A | 19.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10035801 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300001867|JGI12627J18819_10123292 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300002917|JGI25616J43925_10145115 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005541|Ga0070733_10304982 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300005561|Ga0066699_10377569 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005574|Ga0066694_10489490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300006031|Ga0066651_10234343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300006034|Ga0066656_10955100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300006794|Ga0066658_10182972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300007265|Ga0099794_10011751 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
| 3300009012|Ga0066710_101489884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300009548|Ga0116107_1196865 | Not Available | 531 | Open in IMG/M |
| 3300009552|Ga0116138_1029236 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300009615|Ga0116103_1078231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300009629|Ga0116119_1001198 | All Organisms → cellular organisms → Bacteria | 11867 | Open in IMG/M |
| 3300009629|Ga0116119_1001819 | All Organisms → cellular organisms → Bacteria | 8594 | Open in IMG/M |
| 3300009631|Ga0116115_1000687 | All Organisms → cellular organisms → Bacteria | 17161 | Open in IMG/M |
| 3300009634|Ga0116124_1006370 | All Organisms → cellular organisms → Bacteria | 5070 | Open in IMG/M |
| 3300009634|Ga0116124_1103735 | Not Available | 804 | Open in IMG/M |
| 3300009700|Ga0116217_10016781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5859 | Open in IMG/M |
| 3300012202|Ga0137363_11405035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300012917|Ga0137395_10174628 | Not Available | 1483 | Open in IMG/M |
| 3300012917|Ga0137395_11049519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012918|Ga0137396_10072123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2415 | Open in IMG/M |
| 3300012923|Ga0137359_11291887 | Not Available | 618 | Open in IMG/M |
| 3300012984|Ga0164309_10024775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3207 | Open in IMG/M |
| 3300014151|Ga0181539_1005310 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10463 | Open in IMG/M |
| 3300014152|Ga0181533_1010248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7368 | Open in IMG/M |
| 3300014168|Ga0181534_10134680 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300014495|Ga0182015_10384158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300014501|Ga0182024_10004124 | All Organisms → cellular organisms → Bacteria | 33828 | Open in IMG/M |
| 3300014838|Ga0182030_11176340 | Not Available | 657 | Open in IMG/M |
| 3300015197|Ga0167638_1102786 | Not Available | 543 | Open in IMG/M |
| 3300017823|Ga0187818_10433400 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300017925|Ga0187856_1000111 | All Organisms → cellular organisms → Bacteria | 77363 | Open in IMG/M |
| 3300017925|Ga0187856_1000389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 40554 | Open in IMG/M |
| 3300017935|Ga0187848_10000412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 39281 | Open in IMG/M |
| 3300017935|Ga0187848_10418565 | Not Available | 551 | Open in IMG/M |
| 3300017948|Ga0187847_10344941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300017959|Ga0187779_11048353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300017970|Ga0187783_10112202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 2009 | Open in IMG/M |
| 3300018004|Ga0187865_1008199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6221 | Open in IMG/M |
| 3300018005|Ga0187878_1004799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10302 | Open in IMG/M |
| 3300018013|Ga0187873_1004004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10341 | Open in IMG/M |
| 3300018013|Ga0187873_1177185 | Not Available | 805 | Open in IMG/M |
| 3300018015|Ga0187866_1022307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3218 | Open in IMG/M |
| 3300018017|Ga0187872_10481754 | Not Available | 516 | Open in IMG/M |
| 3300018020|Ga0187861_10002637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16618 | Open in IMG/M |
| 3300018022|Ga0187864_10260843 | Not Available | 790 | Open in IMG/M |
| 3300018042|Ga0187871_10086969 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300018042|Ga0187871_10199516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1119 | Open in IMG/M |
| 3300018062|Ga0187784_10243284 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300019787|Ga0182031_1395531 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300020199|Ga0179592_10393734 | Not Available | 605 | Open in IMG/M |
| 3300024330|Ga0137417_1339957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300025160|Ga0209109_10239493 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300025160|Ga0209109_10467987 | Not Available | 578 | Open in IMG/M |
| 3300025419|Ga0208036_1000229 | All Organisms → cellular organisms → Bacteria | 40564 | Open in IMG/M |
| 3300025419|Ga0208036_1003452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4840 | Open in IMG/M |
| 3300025439|Ga0208323_1004646 | All Organisms → cellular organisms → Bacteria | 4115 | Open in IMG/M |
| 3300025441|Ga0208456_1081848 | Not Available | 567 | Open in IMG/M |
| 3300025442|Ga0208034_1000427 | All Organisms → cellular organisms → Bacteria | 35367 | Open in IMG/M |
| 3300025442|Ga0208034_1002214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10365 | Open in IMG/M |
| 3300025442|Ga0208034_1002816 | All Organisms → cellular organisms → Bacteria | 8590 | Open in IMG/M |
| 3300025442|Ga0208034_1005995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4847 | Open in IMG/M |
| 3300025446|Ga0208038_1000124 | All Organisms → cellular organisms → Bacteria | 77406 | Open in IMG/M |
| 3300025459|Ga0208689_1001918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10337 | Open in IMG/M |
| 3300025469|Ga0208687_1074869 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300025472|Ga0208692_1005047 | Not Available | 5422 | Open in IMG/M |
| 3300025477|Ga0208192_1004915 | All Organisms → cellular organisms → Bacteria | 5039 | Open in IMG/M |
| 3300025480|Ga0208688_1000827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 15206 | Open in IMG/M |
| 3300025812|Ga0208457_1024883 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300026296|Ga0209235_1026844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3014 | Open in IMG/M |
| 3300026320|Ga0209131_1405256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026329|Ga0209375_1097498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
| 3300026542|Ga0209805_1162367 | Not Available | 1014 | Open in IMG/M |
| 3300026551|Ga0209648_10050670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3556 | Open in IMG/M |
| 3300026557|Ga0179587_10934557 | Not Available | 571 | Open in IMG/M |
| 3300027370|Ga0209010_1011548 | Not Available | 1612 | Open in IMG/M |
| 3300027537|Ga0209419_1035497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300027548|Ga0209523_1108954 | Not Available | 573 | Open in IMG/M |
| 3300027605|Ga0209329_1055461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300027643|Ga0209076_1080240 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300027768|Ga0209772_10119614 | Not Available | 817 | Open in IMG/M |
| 3300027803|Ga0209910_10038342 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027894|Ga0209068_10004626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6494 | Open in IMG/M |
| 3300027903|Ga0209488_10081470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2409 | Open in IMG/M |
| 3300027911|Ga0209698_10633376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 819 | Open in IMG/M |
| 3300028047|Ga0209526_10338503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300028800|Ga0265338_10115377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2153 | Open in IMG/M |
| 3300029889|Ga0246001_1000417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 28334 | Open in IMG/M |
| 3300029889|Ga0246001_1001939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10309 | Open in IMG/M |
| 3300029889|Ga0246001_1002565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 8578 | Open in IMG/M |
| 3300029982|Ga0302277_1078947 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300030991|Ga0073994_12168571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 957 | Open in IMG/M |
| 3300031128|Ga0170823_11165064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300031236|Ga0302324_103310147 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin4 | 527 | Open in IMG/M |
| 3300031258|Ga0302318_10328024 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031261|Ga0302140_10469484 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031469|Ga0170819_16711686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300031754|Ga0307475_10740035 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031962|Ga0307479_11135308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300031962|Ga0307479_11976343 | Not Available | 532 | Open in IMG/M |
| 3300032261|Ga0306920_101009476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300032261|Ga0306920_103857411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300032805|Ga0335078_11992786 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300034125|Ga0370484_0206685 | Not Available | 538 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 21.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 14.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.80% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.93% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100358011 | 3300001356 | Peatlands Soil | MNRETFALSQKELQRVAIISSCVKGDLPCARAAELLDLTPRHVKR |
| JGI12627J18819_101232922 | 3300001867 | Forest Soil | MNRETFALSQKELQRVEVISASVQGELACARAAELLAITPRHVKR |
| JGI25616J43925_101451152 | 3300002917 | Grasslands Soil | LSQKELQRVAVISRCVKGELACARAAGLLCLSVRQIKRLKKRMR |
| Ga0070733_103049821 | 3300005541 | Surface Soil | MKQETFTLSQKELQRVSVISACIKGDMACARAAGLLC |
| Ga0066699_103775693 | 3300005561 | Soil | MRQETFTLSQKELQRVVVISHCVKGDLACARAAELLDLSPRQVKR |
| Ga0066694_104894901 | 3300005574 | Soil | LSQKELQRVTVISACIKGDMACARAAGLLCLSVRQ |
| Ga0066651_102343432 | 3300006031 | Soil | MNRETFSLSQKELQRVAVISACIKGEVACARAAELL |
| Ga0066656_109551002 | 3300006034 | Soil | MRQETFTLSQKELQRVAVISHCVKGDLVCARAAELLDL |
| Ga0066658_101829721 | 3300006794 | Soil | MRQETFTLSQKELQRVTVISACIKGDMACARAAGLLCLSVRQSKRLKKRMRED |
| Ga0099794_100117516 | 3300007265 | Vadose Zone Soil | LSQKELQRVSVINACIRGDMACARAAALLCLSVRQIKRLK |
| Ga0066710_1014898844 | 3300009012 | Grasslands Soil | MRQETFTLSQKELQRVAVISHCVKGDLVCARAAEL |
| Ga0116107_11968652 | 3300009548 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLL |
| Ga0116138_10292363 | 3300009552 | Peatland | LSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRLKRRLR |
| Ga0116103_10782312 | 3300009615 | Peatland | LSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRLK |
| Ga0116119_100119812 | 3300009629 | Peatland | MRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRL |
| Ga0116119_10018191 | 3300009629 | Peatland | MRQETFTLSQKEMQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRED |
| Ga0116115_100068714 | 3300009631 | Peatland | LRQKELQRVSVITACVKGDMACASAAGLLCLSVRQ |
| Ga0116124_10063706 | 3300009634 | Peatland | MRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRLK |
| Ga0116124_11037351 | 3300009634 | Peatland | MRQETFTLSQKELQRVSVIIACVKVDMACASAAGLLCLSVRQIKRLKRR |
| Ga0116217_100167816 | 3300009700 | Peatlands Soil | MRQETFPLSQKELQRVSVISTCIKGDMACARAAVLLCLSVR |
| Ga0137363_114050352 | 3300012202 | Vadose Zone Soil | MRQETFTLSQKELQRVSVINACIRGDMACARAAAL |
| Ga0137395_101746281 | 3300012917 | Vadose Zone Soil | MNRETFAVSQKELQRVAVISASLKGEVACVRAAEL |
| Ga0137395_110495191 | 3300012917 | Vadose Zone Soil | MNRETFALSQKELQRVAVISRCVKGELACARAAGLLCLSVRQIKRL |
| Ga0137396_100721231 | 3300012918 | Vadose Zone Soil | LSQKELQLVSVINACIRGDMACARAAALLCLSVRQIKRLKKRMRED |
| Ga0137359_112918872 | 3300012923 | Vadose Zone Soil | MRQETFTLSQKELRRVSVINACIRGDMACARAAALLCLSVRQIKRLKKRMRE |
| Ga0164309_100247751 | 3300012984 | Soil | MRQETFTLSQKELQRVSVINACIKADMACARVAGRLGLGVRLVKRLKKLRRED |
| Ga0181539_10053101 | 3300014151 | Bog | MRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIK |
| Ga0181533_10102481 | 3300014152 | Bog | MRQETFTLSQKELQRVSVITACVKGDMACASAAGL |
| Ga0181534_101346803 | 3300014168 | Bog | MRQETFTLSQKELQRVSVISACIKGDMACARAAVLLCLSVRIKSSIIL |
| Ga0182015_103841582 | 3300014495 | Palsa | MRQETFTLSQKELQRVTVISQCVQGNLTCARAAELLDLSPR |
| Ga0182024_100041241 | 3300014501 | Permafrost | MRLETFTLSQKELQRVEVISQCAQGNLACTRAAELLDITPRHV |
| Ga0182030_111763401 | 3300014838 | Bog | MKQETFTLSQKELKRVTVISQCVQGNLTCARAAELL |
| Ga0167638_11027862 | 3300015197 | Glacier Forefield Soil | MNRETFAVSQKELQRVAVISASLKGEVACVRAAELLCLSV |
| Ga0187818_104334002 | 3300017823 | Freshwater Sediment | MRQETSPLSKKELQRVSVISACIKGDMACARAAALLCLSVRQIKRL |
| Ga0187856_10001111 | 3300017925 | Peatland | MRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCLS |
| Ga0187856_100038948 | 3300017925 | Peatland | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL |
| Ga0187848_1000041247 | 3300017935 | Peatland | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLK |
| Ga0187848_104185651 | 3300017935 | Peatland | MRGRTFALSQKELQRVSVISSCVKGDMACARAAELLSLSERHVKRLKKRMREQGEA |
| Ga0187847_103449412 | 3300017948 | Peatland | METYTLSEKELQRVSVISSCVKGNLSCASAAKLLAVTPRHVKRL |
| Ga0187779_110483531 | 3300017959 | Tropical Peatland | MDKGRITLSQRELQRVAVISSCVRGEMACASAAALLSLSVRQVKRLKKR |
| Ga0187783_101122023 | 3300017970 | Tropical Peatland | MGQETFTLSQKELQRVVVISQGNLTCVRAAKLLDLSARQVKRLKARYKQ |
| Ga0187865_10081995 | 3300018004 | Peatland | MRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCL |
| Ga0187878_10047991 | 3300018005 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQI |
| Ga0187873_10040041 | 3300018013 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRR |
| Ga0187873_11771853 | 3300018013 | Peatland | LSQKELQRVSVIIACVKGDMACASAAGLLCLSVRQIKRLKRR |
| Ga0187866_10223071 | 3300018015 | Peatland | MRQETFTLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL |
| Ga0187872_104817541 | 3300018017 | Peatland | MRQETFALSQRELQRVAVISSCVKGDLACARAAALLDLTPRL |
| Ga0187861_100026371 | 3300018020 | Peatland | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKR |
| Ga0187864_102608433 | 3300018022 | Peatland | LSQKELQRVSVIIACVKGDMACASAAGLLCLSVRQIK |
| Ga0187871_100869691 | 3300018042 | Peatland | METYTLSEKELQRVSVISSCVKGNLSCASAAKLLAVTPRHVKRLKARY |
| Ga0187871_101995161 | 3300018042 | Peatland | LSAKELQRVSVISSCVKGNLSCASAAKLLAVTPRHVKRLKARY |
| Ga0187784_102432843 | 3300018062 | Tropical Peatland | MRQETFRLSQKELQRVAVNSSCVKGDLDCAKAGEL |
| Ga0182031_13955311 | 3300019787 | Bog | LSQKELKRVTVISQCVQGNLTCARAAELLDLSPRHVKRLKS |
| Ga0179592_103937341 | 3300020199 | Vadose Zone Soil | MRRETYTLSQKELQRVSVISACIKGDMACARAAALLCLSVRQIK |
| Ga0137417_13399573 | 3300024330 | Vadose Zone Soil | MRQETFTLSQKELQRVSVINACIRGAMACARAAALLCLSVRPIKRLKKRLR |
| Ga0209109_102394931 | 3300025160 | Soil | MKQETFTLSQKELQRVAVISAGVKGRLACGRAAALL |
| Ga0209109_104679871 | 3300025160 | Soil | MRPETFTLSQKELQRVAVISECVRGRLACARAAELLQLSSRHVKRLKLRLRHGGE |
| Ga0208036_100022948 | 3300025419 | Peatland | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRE |
| Ga0208036_10034527 | 3300025419 | Peatland | MRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL |
| Ga0208323_10046461 | 3300025439 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQ |
| Ga0208456_10818481 | 3300025441 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLC |
| Ga0208034_100042735 | 3300025442 | Peatland | LRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL |
| Ga0208034_10022141 | 3300025442 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL |
| Ga0208034_10028168 | 3300025442 | Peatland | LSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL |
| Ga0208034_10059957 | 3300025442 | Peatland | MRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRE |
| Ga0208038_100012474 | 3300025446 | Peatland | LSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRE |
| Ga0208689_10019181 | 3300025459 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVR |
| Ga0208687_10748692 | 3300025469 | Peatland | MRQETFTLRQKELQRVSVITACVKGDMACASAAGL |
| Ga0208692_10050471 | 3300025472 | Peatland | MRQETFTLSQKELQRVSVIIACVKGDMACASAAGLLCLSV |
| Ga0208192_10049151 | 3300025477 | Peatland | MRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLS |
| Ga0208688_100082719 | 3300025480 | Peatland | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQI |
| Ga0208457_10248831 | 3300025812 | Peatland | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQ |
| Ga0209235_10268445 | 3300026296 | Grasslands Soil | MRQETFTLSQKELQRVAVISHCVKGDLVCARAAELLDLSPR |
| Ga0209131_14052561 | 3300026320 | Grasslands Soil | MRQETFALSQKELQRVAVISSCVKGELACARAASLLNLTPRHVKRLKSRL |
| Ga0209375_10974982 | 3300026329 | Soil | LSQKELQRVAVISACIKGEMACARAAELLCLSVRQIKRLK |
| Ga0209805_11623671 | 3300026542 | Soil | MRQETFTLSQKELRRVVVISHCVKGDLACARAAELLDLSPRQVKR |
| Ga0209648_100506706 | 3300026551 | Grasslands Soil | VSVISSCVKGNMACARAAELLSLSVRQVKRLKKRF |
| Ga0179587_109345571 | 3300026557 | Vadose Zone Soil | VSQKELQRVAVISASLKGEVACVRAAELLCLSVRQIKRLR |
| Ga0209010_10115482 | 3300027370 | Forest Soil | MKQETFALSQKELQRVAVISSCVKGDLTCARAAEL |
| Ga0209419_10354972 | 3300027537 | Forest Soil | MNRETFAVSQKELQRVAVISASLKGEVACVRAAELLCLSVRQIK |
| Ga0209523_11089542 | 3300027548 | Forest Soil | MNRETFGVSQKELQRVAVISACIKGELACARAAELLCLSVRQI |
| Ga0209329_10554611 | 3300027605 | Forest Soil | MNRETFAVSQKELQRVAVISASLKGEVACVRAAELLCLSVRQIKRLRKRMRED |
| Ga0209076_10802402 | 3300027643 | Vadose Zone Soil | MSPMNRETFSLSQKELQRVAVISACIKGEVACARAAELLCLSVR |
| Ga0209772_101196141 | 3300027768 | Bog Forest Soil | MRQETFTLSQKELQRVSVISACIKGDMACARAAALLCLSVRQIKRLKKRMRE |
| Ga0209910_100383421 | 3300027803 | Thawing Permafrost | MSQETFHLSQKELQRVAVIAACVKGEVACARAAELLDLTP |
| Ga0209068_100046266 | 3300027894 | Watersheds | METYTLSKKELQRVAVISSCVKGDLACARAASLLHLTPRHVKQLKFRLRQGAEAALAHARSP |
| Ga0209488_100814701 | 3300027903 | Vadose Zone Soil | MNGETFALSQKELQRVAVISRCVKGELACARAAGL |
| Ga0209698_106333761 | 3300027911 | Watersheds | LSQKELQRVSVISSLAKGDMACARAAELLSLSERHVKRLKK |
| Ga0209526_103385031 | 3300028047 | Forest Soil | MRQETFTLSQKELQRVSVINACIKGEMACARAAGL |
| Ga0265338_101153775 | 3300028800 | Rhizosphere | VSVISSCVKGDMACARAAALLSLSVRQVKRLKQRLREQ |
| Ga0246001_100041736 | 3300029889 | Peat | LSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIK |
| Ga0246001_10019398 | 3300029889 | Peat | MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIK |
| Ga0246001_10025651 | 3300029889 | Peat | LSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKR |
| Ga0302277_10789471 | 3300029982 | Bog | MRGRTYALSQKELQRVSVISSLAKGDMACARAAELLSLSERHVKRLKKR |
| Ga0073994_121685711 | 3300030991 | Soil | MRQATFPLSQKELQRVSVISACIKIKGDMACASVAELLCLSVRQVKRL |
| Ga0170823_111650642 | 3300031128 | Forest Soil | MRGRTFALKQKELQRVSVISSCVKGDMACARAAELLSLSIR |
| Ga0302324_1033101471 | 3300031236 | Palsa | VSVISSLAKGNMACARAAELLSLSERHVKRLKKRMR |
| Ga0302318_103280241 | 3300031258 | Bog | MRGRTYALSQKELQRVSVISSLAKGDMACARAAEQRALSERHVKRHKKTIREQGE |
| Ga0302140_104694842 | 3300031261 | Bog | MSQETFHLSQKELQRVAVIAACVKGEVAGARAAERRDLTPRQIKRRKAG |
| Ga0170819_167116862 | 3300031469 | Forest Soil | MRQETFTLSQKELQRVIVISRCVQGNLTCARAAELLDLSPRPPQ |
| Ga0307475_107400351 | 3300031754 | Hardwood Forest Soil | MNRETFALSQKELQRVEVISASVQGELACARAAELLAITPRHVKRLKAR |
| Ga0307479_111353082 | 3300031962 | Hardwood Forest Soil | MSQETFRVSQKELQRVAVIASCVKGDLACARAAELLDLTPRQ |
| Ga0307479_119763431 | 3300031962 | Hardwood Forest Soil | MNRETFAVSQKELQRVAVISASLKGEVACVRAAEVLCL |
| Ga0306920_1010094761 | 3300032261 | Soil | LNQKELQRVSAIGACIKGDMACASAAELLSLSVRHVKR |
| Ga0306920_1038574112 | 3300032261 | Soil | MRQETFTLNQKELQRVSVIGACIKGDMACASAAELLSLSVRHV |
| Ga0335078_119927861 | 3300032805 | Soil | MFALSQKELQRVSVISACVKGDMACGRAAAQLSRSK |
| Ga0370484_0206685_408_536 | 3300034125 | Untreated Peat Soil | MNRETFRLSQKELQRVAVISSCIKGDLACARAAELLAITSRHV |
| ⦗Top⦘ |