


| Basic Information | |
|---|---|
| Family ID | F091671 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELL |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.11 % |
| % of genes near scaffold ends (potentially truncated) | 95.33 % |
| % of genes from short scaffolds (< 2000 bps) | 93.46 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.776 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.991 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 0.00% Coil/Unstructured: 89.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02735 | Ku | 73.83 |
| PF06559 | DCD | 1.87 |
| PF01336 | tRNA_anti-codon | 0.93 |
| PF12833 | HTH_18 | 0.93 |
| PF13460 | NAD_binding_10 | 0.93 |
| PF04392 | ABC_sub_bind | 0.93 |
| PF01053 | Cys_Met_Meta_PP | 0.93 |
| PF00589 | Phage_integrase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 73.83 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.87 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.93 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.93 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.93 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.93 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.93 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.93 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.93 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.93 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.93 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.26 % |
| Unclassified | root | N/A | 3.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17473762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1205 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100486256 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1012829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10007632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2555 | Open in IMG/M |
| 3300000955|JGI1027J12803_102937050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 946 | Open in IMG/M |
| 3300000955|JGI1027J12803_104284628 | Not Available | 1135 | Open in IMG/M |
| 3300000956|JGI10216J12902_105532527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
| 3300001545|JGI12630J15595_10110668 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300004114|Ga0062593_100324508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1328 | Open in IMG/M |
| 3300005332|Ga0066388_101529229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1169 | Open in IMG/M |
| 3300005332|Ga0066388_108668308 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005444|Ga0070694_101264508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300005556|Ga0066707_10276709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
| 3300005557|Ga0066704_10143975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1595 | Open in IMG/M |
| 3300005559|Ga0066700_10216127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1329 | Open in IMG/M |
| 3300005764|Ga0066903_100908726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1594 | Open in IMG/M |
| 3300005764|Ga0066903_102922300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300006797|Ga0066659_10484835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 989 | Open in IMG/M |
| 3300006845|Ga0075421_102511598 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006847|Ga0075431_101189999 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006853|Ga0075420_100477640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300006903|Ga0075426_11348928 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009094|Ga0111539_12192179 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010037|Ga0126304_11161369 | Not Available | 529 | Open in IMG/M |
| 3300010043|Ga0126380_10717808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300010043|Ga0126380_11712328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300010358|Ga0126370_12139920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300010361|Ga0126378_12879732 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010362|Ga0126377_11447598 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010376|Ga0126381_103227463 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010376|Ga0126381_105134604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium RH AL1 | 501 | Open in IMG/M |
| 3300010396|Ga0134126_10725647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1128 | Open in IMG/M |
| 3300010400|Ga0134122_10490646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1109 | Open in IMG/M |
| 3300010868|Ga0124844_1022228 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300010868|Ga0124844_1052036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1443 | Open in IMG/M |
| 3300012015|Ga0120187_1029199 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012202|Ga0137363_11360354 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012204|Ga0137374_10309848 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300012918|Ga0137396_11010229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300012971|Ga0126369_11292524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300012971|Ga0126369_11981595 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012971|Ga0126369_13100768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300015372|Ga0132256_101344981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300016319|Ga0182033_10429851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1122 | Open in IMG/M |
| 3300016341|Ga0182035_11681449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300016341|Ga0182035_12014230 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300016357|Ga0182032_10439151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1063 | Open in IMG/M |
| 3300016357|Ga0182032_10600526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300016371|Ga0182034_11640985 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300016387|Ga0182040_11709760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300016404|Ga0182037_11288702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300016445|Ga0182038_11246812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300017654|Ga0134069_1145979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
| 3300018431|Ga0066655_10204700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1223 | Open in IMG/M |
| 3300018468|Ga0066662_12580503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 536 | Open in IMG/M |
| 3300020581|Ga0210399_10810662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300021178|Ga0210408_10823984 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300026330|Ga0209473_1130163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
| 3300026332|Ga0209803_1074278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300026550|Ga0209474_10124818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
| 3300027502|Ga0209622_1021742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300027748|Ga0209689_1271755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300028536|Ga0137415_10899106 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300028708|Ga0307295_10096458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300028768|Ga0307280_10144997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300031152|Ga0307501_10290671 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031561|Ga0318528_10060953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1926 | Open in IMG/M |
| 3300031564|Ga0318573_10220962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300031564|Ga0318573_10362300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300031572|Ga0318515_10541168 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031573|Ga0310915_11195420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300031713|Ga0318496_10446892 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031724|Ga0318500_10153680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1084 | Open in IMG/M |
| 3300031740|Ga0307468_100919284 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031747|Ga0318502_10006807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4960 | Open in IMG/M |
| 3300031747|Ga0318502_10486669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300031751|Ga0318494_10258011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300031765|Ga0318554_10201085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1134 | Open in IMG/M |
| 3300031771|Ga0318546_11321589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300031795|Ga0318557_10414021 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031798|Ga0318523_10135153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1222 | Open in IMG/M |
| 3300031805|Ga0318497_10019845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3249 | Open in IMG/M |
| 3300031805|Ga0318497_10347482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
| 3300031821|Ga0318567_10362074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300031821|Ga0318567_10475271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300031821|Ga0318567_10738506 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031832|Ga0318499_10155093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300031832|Ga0318499_10314660 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031833|Ga0310917_10627215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300031890|Ga0306925_10031367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5424 | Open in IMG/M |
| 3300031912|Ga0306921_10404323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1593 | Open in IMG/M |
| 3300031941|Ga0310912_10060873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2686 | Open in IMG/M |
| 3300031945|Ga0310913_10113951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1841 | Open in IMG/M |
| 3300031947|Ga0310909_10854151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300032001|Ga0306922_10212672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2075 | Open in IMG/M |
| 3300032001|Ga0306922_10284453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1776 | Open in IMG/M |
| 3300032043|Ga0318556_10578857 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032054|Ga0318570_10272464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
| 3300032055|Ga0318575_10445684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300032067|Ga0318524_10662175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300032076|Ga0306924_12558141 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032090|Ga0318518_10568196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300032180|Ga0307471_104065218 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032805|Ga0335078_10430541 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300033290|Ga0318519_10609453 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300033290|Ga0318519_10613170 | Not Available | 661 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02343440 | 2088090014 | Soil | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWYVEAESPEQARDLL |
| INPhiseqgaiiFebDRAFT_1004862561 | 3300000364 | Soil | MALADLKRPAKLKTFHASMLVTRTEEWYVEAESAAQARALL |
| AF_2010_repII_A100DRAFT_10128291 | 3300000655 | Forest Soil | MAVAALKLKPSLKTYHATVHVTRTEQWCVEAESAEQA |
| AF_2010_repII_A001DRAFT_100076323 | 3300000793 | Forest Soil | MAVAALKLKPSLKTYHATVHVTRTEQWCVEAESAEQARDLL |
| JGI1027J12803_1029370501 | 3300000955 | Soil | MPVAALKLKPKLKTFYATVHVTRVEEWCVEAESEEEAR |
| JGI1027J12803_1042846283 | 3300000955 | Soil | MAVAALKQKPILSTFHATVHVHSHGAEAEAAEEARELLSAGAGNRCDIGDV* |
| JGI10216J12902_1055325271 | 3300000956 | Soil | MARAAVRPKLKTFHATMRIIRTEEWCVEAETPEEARAL |
| JGI12630J15595_101106682 | 3300001545 | Forest Soil | MAVAALKLKPELKTFHATVHVTRVEQWCVEAETAEEAR |
| Ga0062593_1003245083 | 3300004114 | Soil | MAVAAPKRKPKLKMFHATMHVTRVEEWCVEAATAEEAREL |
| Ga0066388_1015292292 | 3300005332 | Tropical Forest Soil | MAVAALKNTPKLKNPPKLKTFHATVHVTRVEEWYVEAESPEQARDLLAAGA |
| Ga0066388_1086683081 | 3300005332 | Tropical Forest Soil | MAVAALKNTPKLKNPPKLKTFHATVHVTRVEEWYVEAESPEQARDLLAAGAGC |
| Ga0070694_1012645081 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWYVEAESP |
| Ga0066707_102767091 | 3300005556 | Soil | MAVAALKQKPALKTFQATVQVTRIEQWCVEAETAEEARELLAAGHGY |
| Ga0066704_101439751 | 3300005557 | Soil | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWYVEAESPEQARDLLAAGAGYR |
| Ga0066700_102161272 | 3300005559 | Soil | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWYVEAESPEQ |
| Ga0066903_1009087263 | 3300005764 | Tropical Forest Soil | MAIVALKQKPTLKTFHATVHVTRVEQWCVEAETAEEAREL* |
| Ga0066903_1029223001 | 3300005764 | Tropical Forest Soil | MAVAALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGA |
| Ga0066659_104848352 | 3300006797 | Soil | MAVAALKQRPERRPALKTYHATVHVTRTEQWCVEAHSAEEAH |
| Ga0075421_1025115982 | 3300006845 | Populus Rhizosphere | MGMAALRQKPKLKTFHWTVHATRIEQWFVEAESAEEARELLTAGEG |
| Ga0075431_1011899991 | 3300006847 | Populus Rhizosphere | MAVAALKREPQRKIFYATVHVTRVEEWCIEAESAEE |
| Ga0075420_1004776402 | 3300006853 | Populus Rhizosphere | MGMAALKLKPRLKTFRATVHVTRVEEWFVEAESAEEAREL |
| Ga0075426_113489281 | 3300006903 | Populus Rhizosphere | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWYVEAESPEQARD |
| Ga0111539_121921791 | 3300009094 | Populus Rhizosphere | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWFVEAESAEEARELLSAGEGHR |
| Ga0126304_111613691 | 3300010037 | Serpentine Soil | MARSAAKTKPKLFHATMHVTRTEQWCVEADSAQEARA |
| Ga0126380_107178082 | 3300010043 | Tropical Forest Soil | MGMAALKQKPKLRTFHATVHVTRVEEWFVEAQSAEEARE |
| Ga0126380_117123282 | 3300010043 | Tropical Forest Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCIEAETAEEA |
| Ga0126370_121399202 | 3300010358 | Tropical Forest Soil | MAVVALKQKPPLKTFHATVHVTRVEQWCVEAETVEEARELLAAG |
| Ga0126378_128797322 | 3300010361 | Tropical Forest Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEACELLA |
| Ga0126377_114475981 | 3300010362 | Tropical Forest Soil | MAALKQKPKLKTFHATVHVTRVEEWFVEAESAEEARELLTAG |
| Ga0126381_1032274632 | 3300010376 | Tropical Forest Soil | MAVAALKNKSKLKTFHATVHVTRIEEWYVEAESPEQARDLL |
| Ga0126381_1051346042 | 3300010376 | Tropical Forest Soil | MAVAALKNKSKLKTFHATVHVTRVEEWYVEAESPEQARDLLA |
| Ga0134126_107256471 | 3300010396 | Terrestrial Soil | MAVAALKLKPVFKTYHATVQVTRVEQWCVEAQSAEEARELL |
| Ga0134122_104906461 | 3300010400 | Terrestrial Soil | MAVAALKLKPVFKTYHATVQVTRIEQWCVEAQSAEEARELF |
| Ga0124844_10222283 | 3300010868 | Tropical Forest Soil | MAVVALKRKPLLKTFHATVHVTRVEQWCVEAETVEEARELLAAG |
| Ga0124844_10520361 | 3300010868 | Tropical Forest Soil | MAVVALKRKPLLKTFHATVHVTRVEQWCVEAETVEEARELLAAGA |
| Ga0120187_10291992 | 3300012015 | Terrestrial | MAVSALKQKPKLKTFHATVHVTRVEEWFVEAESAQQARELLAAGEGHRS |
| Ga0137363_113603542 | 3300012202 | Vadose Zone Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEE |
| Ga0137374_103098482 | 3300012204 | Vadose Zone Soil | MSAAAEKTRLKTFHATMAVTRLEEWCVDAETPEEA |
| Ga0137396_110102291 | 3300012918 | Vadose Zone Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEETRELLPV |
| Ga0126369_112925241 | 3300012971 | Tropical Forest Soil | MAVAALKNTPKLKTFHATVHVTRVEEWYVEAESPEQA |
| Ga0126369_119815952 | 3300012971 | Tropical Forest Soil | MGMAALKQKPKLRTFHATVHVTRVEEWFVEAQSAEEARELLTAGE |
| Ga0126369_131007682 | 3300012971 | Tropical Forest Soil | MAVVALKQKPLLKTFHTTVHVTRVEQWCVEAETAEEARELLAAGAGYRCEIWVRS* |
| Ga0132256_1013449812 | 3300015372 | Arabidopsis Rhizosphere | MAVAAHKQEPAPSLKTFHATVLVTRTEEWCVEAETAEEARQLLTL |
| Ga0182033_104298511 | 3300016319 | Soil | MAVAALKQKPQLKTFYATMHVTRVEEWFVEAETAEEARELLL |
| Ga0182035_116814492 | 3300016341 | Soil | MAIVALKQKPTLKTFHATFHVTRVEQWCVEAETAEEARELLAAGVG |
| Ga0182035_120142301 | 3300016341 | Soil | MAVAALKQKPQLKTFYATMHVTRVEEWFVEAETAEEARELLLSGAG |
| Ga0182032_104391511 | 3300016357 | Soil | LEVIRRLRKPMAVAALKRRPELKTFHATLLVTRAEEWCIEAETPEEARELLAIG |
| Ga0182032_106005261 | 3300016357 | Soil | MAVAALKNTPKLKNPPKLKTFHATVHATRVEEWYVEAESP |
| Ga0182034_116409852 | 3300016371 | Soil | MAVVALKQKPRLKTFHATVHVTRVEQWCVEAETAEEARELLAAGA |
| Ga0182040_117097602 | 3300016387 | Soil | MAVVALKQRPLLKTFHATVYVTRVEQWCVEAETAEEARELLAAGVGYR |
| Ga0182037_112887023 | 3300016404 | Soil | MAVAALKLKPKLKTFHAIVHVTRVEEWCVEAETAEEA |
| Ga0182038_112468122 | 3300016445 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEAR |
| Ga0134069_11459792 | 3300017654 | Grasslands Soil | MAVAALKQRPVLKTFHATVNVTRMEQWCVEAQSAEHARELL |
| Ga0066655_102047001 | 3300018431 | Grasslands Soil | MAVAALKNTSKLKNPPKLKTFHATVHVTRIEEWYVEAESPEQARDLLA |
| Ga0066667_109130382 | 3300018433 | Grasslands Soil | MAVAALKQRPERRPALKTYHATVHVTRTEQWCVEAHSAEEAHELLAAGAGY |
| Ga0066662_125805031 | 3300018468 | Grasslands Soil | MAVAALKLKPELKTFYATVHVTRMERWCIEAETTEEARELLAAGDG |
| Ga0210399_108106622 | 3300020581 | Soil | MAVAALKLKPVFKTYHATVQVTRIEQWCVEAQSAEEA |
| Ga0210408_108239841 | 3300021178 | Soil | MAVAALKQKPALKTFQATVHVTRTEQWCVEAETAEEARELLAAGHGYRPRVLRDRWM |
| Ga0209473_11301632 | 3300026330 | Soil | MAVALKQRPVLKTFHATVNVTRMEQWCVEAQSAEHARELLASGAG |
| Ga0209803_10742781 | 3300026332 | Soil | MAVAALKQRPVLKTFHATVNVTRMEQWCVEAQSAEHARELLASGAG |
| Ga0209474_101248181 | 3300026550 | Soil | MAVAALKRKARLKLFHATVHVTRVEEWSVEAESAEAARELLA |
| Ga0209622_10217421 | 3300027502 | Forest Soil | MAVAALKNKSKLKTFHATVHVTRVEEWFVEAESPEQARDLLAAGAG |
| Ga0209689_12717551 | 3300027748 | Soil | MAVAALKQRPVLKTFHATVNVTRMEQWCVEAQSAEH |
| Ga0137415_108991061 | 3300028536 | Vadose Zone Soil | MAVAALKNTSKLKTFHATVHVTRVEEWHVEAESPE |
| Ga0307295_100964581 | 3300028708 | Soil | MAVAAHKQEPAPSLKTFHATVLVTRTEEWCVEAETAEEARQLLTLGV |
| Ga0307280_101449972 | 3300028768 | Soil | MAVAALKLKPVFKTYHATVQVTRIEQWCVEAQSAEDARELLAAGAGY |
| Ga0307501_102906712 | 3300031152 | Soil | MSNLEKTRLKTFHATMVVTRIEEWCVDAESPEEAT |
| Ga0318528_100609534 | 3300031561 | Soil | MAVAALKHKPKLKTFHATLHGTRVEEWYVEAESLE |
| Ga0318573_102209621 | 3300031564 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGVGYRC |
| Ga0318573_103623001 | 3300031564 | Soil | MAVAALKHKPKLKTFHATLHVTRVEEWYVEAESLEQARHLLA |
| Ga0318515_105411681 | 3300031572 | Soil | LKLKPKLKTFHAIVHVTRVEEWCVEAETAEEARELLAA |
| Ga0310915_111954201 | 3300031573 | Soil | MAVGALKQKPILKTFRATVHVTRTEPWCIEAEAAEEARELLS |
| Ga0318496_104468923 | 3300031713 | Soil | MAVAALKNTPKLKNPPKLKTFHATVHVTRVEEWYVEAESPEQARDLLAAG |
| Ga0318500_101536801 | 3300031724 | Soil | MAVAALKHKPKLKTFHATLHVTRVEEWYVEAESLEQARHLLAAGAGYR |
| Ga0307468_1009192842 | 3300031740 | Hardwood Forest Soil | MAVAALKREPQRKMFYATMHVTRVEEWCIEAQSAEEAQELL |
| Ga0318502_100068071 | 3300031747 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAG |
| Ga0318502_104866691 | 3300031747 | Soil | MAVAALKLKPKLKTFHAIVHVTRVEEWCVEAETAEE |
| Ga0318494_102580112 | 3300031751 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLA |
| Ga0318554_102010851 | 3300031765 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGAGHR |
| Ga0318546_113215891 | 3300031771 | Soil | MAVVALKQRPLLKTFHATVYVTRVEQWCVEAETAEEA |
| Ga0318557_104140212 | 3300031795 | Soil | MAVVALKQRPLVKTFHATVHVTRVEQWCVEAETAEEAREL |
| Ga0318523_101351531 | 3300031798 | Soil | MAVVALKQKPRLKTFHATVHVTRVEQWCVEAETAEE |
| Ga0318497_100198451 | 3300031805 | Soil | MAVAALKNKSKLKTFHATVHVTRVEEWYVEAESPEQARDLLAAGAG |
| Ga0318497_103474821 | 3300031805 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGAG |
| Ga0318567_103620742 | 3300031821 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGAGYRC |
| Ga0318567_104752712 | 3300031821 | Soil | MAVAALKHKPKLKTFHATLHVTRVEEWYVEAESLEQAR |
| Ga0318567_107385061 | 3300031821 | Soil | MAVAALKNKSKLKTFHATVHVTRVEEWYVEAESPEQAR |
| Ga0318499_101550932 | 3300031832 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEA |
| Ga0318499_103146601 | 3300031832 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGV |
| Ga0310917_106272151 | 3300031833 | Soil | MAVVALKQKPRLKTFHATVHVTRVEQWCVEAETAEEARELLAAG |
| Ga0306925_100313679 | 3300031890 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEAREL |
| Ga0306921_104043231 | 3300031912 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAGVGY |
| Ga0310912_100608733 | 3300031941 | Soil | MAVAALKNTPKLKNPPKLKTFHATVHVTRVEEWYVEAESPEQA |
| Ga0310913_101139513 | 3300031945 | Soil | MAVVALKQRPLLKTFHATVHVTRVEQWCVEAETAEEARELLAAG |
| Ga0310909_108541511 | 3300031947 | Soil | MAVVALKQKPRLKTFHATVHVTRVEQWCVEAETAEEA |
| Ga0306922_102126721 | 3300032001 | Soil | MAVVALKQKPRLKTFHATVHVTRVEQWCVEAETAEDARELLAAG |
| Ga0306922_102844531 | 3300032001 | Soil | LKNTPKLKNPPKLKTFHATVHVTRVEEWYVEAESPEQA |
| Ga0318556_105788571 | 3300032043 | Soil | MAVVALKQRPLVKTFHATVHVTRVEQWCVEAETAE |
| Ga0318570_102724642 | 3300032054 | Soil | MAVAALKLKPKLKTFHAIVHVTRVEEWCVEAETAEEARELL |
| Ga0318575_104456841 | 3300032055 | Soil | MAVVALKQRPLVKTFHATVHVTRVEQWCVEAETAEEARELLAAGAGHR |
| Ga0318524_106621751 | 3300032067 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARELL |
| Ga0306924_125581412 | 3300032076 | Soil | MAVAALKLKPKLKTFHAIVHVTRVEEWCVEAETAEEAR |
| Ga0318518_105681962 | 3300032090 | Soil | MAVAALKNTPKLKNPPKLKTFHATVHATRVEEWYVEAESPEQA |
| Ga0307471_1040652181 | 3300032180 | Hardwood Forest Soil | MAVAALKNASKLKNSPKLKTYNATVHVTRIEEWYVEAESPEQSRDLLAA |
| Ga0335078_104305413 | 3300032805 | Soil | MPATARKLVQKPRLRAYYATVLVTRVEEWWVEAESEEEARALLTS |
| Ga0318519_106094532 | 3300033290 | Soil | MAVVALKQKPLLKTFHATVHVTRVEQWCVEAETAEEARE |
| Ga0318519_106131701 | 3300033290 | Soil | MAVAAPKQKPRLKTFHATMHVTRTRTEQWCVETEAAKKH |
| ⦗Top⦘ |