


| Basic Information | |
|---|---|
| Family ID | F091665 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 50 residues |
| Representative Sequence | GLSIEIQATPVRYEKHAEGYLIGARISAMSDRNRELFEEYLRELSET |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 96.26 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.561 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.187 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.206 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.33% β-sheet: 29.33% Coil/Unstructured: 49.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01242 | PTPS | 74.77 |
| PF13307 | Helicase_C_2 | 8.41 |
| PF02954 | HTH_8 | 1.87 |
| PF03621 | MbtH | 1.87 |
| PF14698 | ASL_C2 | 0.93 |
| PF00583 | Acetyltransf_1 | 0.93 |
| PF07676 | PD40 | 0.93 |
| PF00694 | Aconitase_C | 0.93 |
| PF02082 | Rrf2 | 0.93 |
| PF06733 | DEAD_2 | 0.93 |
| PF09347 | DUF1989 | 0.93 |
| PF13442 | Cytochrome_CBB3 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 74.77 |
| COG1199 | Rad3-related DNA helicase DinG | Replication, recombination and repair [L] | 1.87 |
| COG3251 | MbtH family protein, regulates adenylation domains of NRPSs | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.87 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.93 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.93 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.93 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.93 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.93 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.93 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.93 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.13 % |
| Unclassified | root | N/A | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig21432 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300000574|JGI1357J11328_10019198 | All Organisms → cellular organisms → Bacteria | 3422 | Open in IMG/M |
| 3300000789|JGI1027J11758_12519272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300000955|JGI1027J12803_105111672 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300004633|Ga0066395_10385845 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005093|Ga0062594_102421429 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005166|Ga0066674_10258112 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005167|Ga0066672_10281675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300005172|Ga0066683_10607219 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005179|Ga0066684_10465259 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300005184|Ga0066671_10844505 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005440|Ga0070705_100835067 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005445|Ga0070708_100697764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300005445|Ga0070708_100741983 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300005450|Ga0066682_10868208 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005454|Ga0066687_10081266 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300005454|Ga0066687_10746385 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005459|Ga0068867_100179816 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300005466|Ga0070685_10765931 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005468|Ga0070707_102258382 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005518|Ga0070699_101278563 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005535|Ga0070684_101840923 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005540|Ga0066697_10733415 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005543|Ga0070672_101651586 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005545|Ga0070695_100279611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300005545|Ga0070695_101020189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300005556|Ga0066707_10671777 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005568|Ga0066703_10591944 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005576|Ga0066708_10084281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1858 | Open in IMG/M |
| 3300005598|Ga0066706_10659520 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005615|Ga0070702_101207021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005840|Ga0068870_10194314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300005841|Ga0068863_101087290 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005842|Ga0068858_100298670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
| 3300006797|Ga0066659_10937707 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006844|Ga0075428_100231421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1994 | Open in IMG/M |
| 3300006845|Ga0075421_102107407 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006852|Ga0075433_10128419 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300006876|Ga0079217_10132638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300007265|Ga0099794_10335108 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300009012|Ga0066710_103940584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009012|Ga0066710_104905360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300009088|Ga0099830_11359910 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009089|Ga0099828_10090010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2637 | Open in IMG/M |
| 3300009137|Ga0066709_101216147 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300009137|Ga0066709_104178096 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009176|Ga0105242_10684527 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300009177|Ga0105248_12974470 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010046|Ga0126384_10861709 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010047|Ga0126382_11513522 | Not Available | 618 | Open in IMG/M |
| 3300010304|Ga0134088_10154154 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300010335|Ga0134063_10561966 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010399|Ga0134127_10951712 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300010399|Ga0134127_11624364 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010400|Ga0134122_11188547 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010401|Ga0134121_10584316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1042 | Open in IMG/M |
| 3300010403|Ga0134123_11202352 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300011436|Ga0137458_1238908 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012199|Ga0137383_10495679 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300012203|Ga0137399_10922146 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012351|Ga0137386_10042872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3110 | Open in IMG/M |
| 3300012355|Ga0137369_10297659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1198 | Open in IMG/M |
| 3300012361|Ga0137360_11198044 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012361|Ga0137360_11556306 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012582|Ga0137358_10365528 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012582|Ga0137358_10943958 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012683|Ga0137398_10618290 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012918|Ga0137396_11217552 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012923|Ga0137359_10036469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4242 | Open in IMG/M |
| 3300012925|Ga0137419_10248960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1338 | Open in IMG/M |
| 3300012929|Ga0137404_10055717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3048 | Open in IMG/M |
| 3300012944|Ga0137410_10960299 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012948|Ga0126375_10425056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 968 | Open in IMG/M |
| 3300012960|Ga0164301_11788650 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300013297|Ga0157378_10270915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1633 | Open in IMG/M |
| 3300013308|Ga0157375_10447612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300014326|Ga0157380_10217506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1707 | Open in IMG/M |
| 3300014326|Ga0157380_12367460 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300015053|Ga0137405_1351528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2907 | Open in IMG/M |
| 3300015241|Ga0137418_10617130 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300015252|Ga0180075_1066533 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300015372|Ga0132256_100399517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1476 | Open in IMG/M |
| 3300015372|Ga0132256_102184192 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300015374|Ga0132255_102865762 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300015374|Ga0132255_105071636 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018433|Ga0066667_11244170 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300019885|Ga0193747_1130481 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300021082|Ga0210380_10596286 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025901|Ga0207688_10273472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300025908|Ga0207643_10498357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 778 | Open in IMG/M |
| 3300025910|Ga0207684_11748488 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025927|Ga0207687_10943641 | Not Available | 739 | Open in IMG/M |
| 3300026035|Ga0207703_10255427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1582 | Open in IMG/M |
| 3300026089|Ga0207648_10739882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 913 | Open in IMG/M |
| 3300026142|Ga0207698_11052745 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300026304|Ga0209240_1193474 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300026496|Ga0257157_1035060 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300026550|Ga0209474_10446006 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300026551|Ga0209648_10714493 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300026552|Ga0209577_10124500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2059 | Open in IMG/M |
| 3300027616|Ga0209106_1159613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027637|Ga0209818_1139384 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300027903|Ga0209488_10141004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300027903|Ga0209488_11102326 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027909|Ga0209382_11792520 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300028536|Ga0137415_11287384 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031716|Ga0310813_11854574 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_00699780 | 2124908044 | Soil | GSEGSMSIELDLPTGASIEVEATPVWFENHPEGYLIGARISQISERDRELLREFLREIGE |
| JGI1357J11328_100191984 | 3300000574 | Groundwater | LPNGLSIEIQATPVRYEKLDEGYVIGARISEMSDRNREMFEEYLRELSAG* |
| JGI1027J11758_125192723 | 3300000789 | Soil | EGSMSIELDLPNGGSVEIQATPVRYEKRDDGYLIGAQISEMSERDREVFEEYLSELTGK* |
| JGI1027J12803_1051116722 | 3300000955 | Soil | DLPNGVSLEIQATPVRYEKRDDGYLIGAQISQMSDRDRELYEEYLKQLAG* |
| Ga0066395_103858451 | 3300004633 | Tropical Forest Soil | NGLSLEIHATPVRYEKLDKGYLIGAQISDMKDRDRELYEQYLHEIAGE* |
| Ga0062594_1024214292 | 3300005093 | Soil | MSIELDLPNGVSLEIQATPVRYEKRDDGYLIGAQISQMSDRDRELYEEYLNDIAAGESNKTKS* |
| Ga0066674_102581123 | 3300005166 | Soil | LSIEIQATPVRHEKLDEGYLIGARISDMSPHNRELFEEYLGELAEE* |
| Ga0066672_102816751 | 3300005167 | Soil | EIQATPVRYQKLGEGYLIGARISEMTDRDRELYLEYLGELAEG* |
| Ga0066683_106072191 | 3300005172 | Soil | IELDLPNGLSIEIQATPVRYEKLEEGYLIGVRISQMSERNREFFEEYLREIAEG* |
| Ga0066684_104652591 | 3300005179 | Soil | ELDLPNGLSIEIQATPVRHEKLDEGYLIGARISDMSPHNRELFEEYLGELAEE* |
| Ga0066671_108445052 | 3300005184 | Soil | PNGLSLEIQATPVRYEQFEEGYLIGARISAMKPRDRELFDEYLEEIGED* |
| Ga0070705_1008350671 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IELDLPTGASIEVEATPVWHENHEEGYLIGARISRISERDRELLLEYLSTLDE* |
| Ga0070708_1006977643 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GLSIEIQATPVRYEKRDEGYLIGARISEMSERDRGLFKEYLSELEQG* |
| Ga0070708_1007419832 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GLSIEIQATPVRYEKRDEGYLIGARISEMSERDRGLFKEYLGELTAS* |
| Ga0066682_108682081 | 3300005450 | Soil | QATPVRHEKLDEGYLIGARISDMSPHNRELFEEYLGELAEE* |
| Ga0066687_100812663 | 3300005454 | Soil | MAIELDLPNGLSLEIHATPVRYEKLEEGYLIGARISRMKPRDRELFEEYLEEIGED* |
| Ga0066687_107463852 | 3300005454 | Soil | QYLSGKEGSMAIELDLPSGLSIEIQATPVRHEKLVEGYLIGARISDMSPRDRDLFEEYLRELEES* |
| Ga0068867_1001798161 | 3300005459 | Miscanthus Rhizosphere | LMGGEDSLAIELDLPNGLSLEIHATPVRYEKLDEGYLLGARISAMKDRDRELYEEYLEEIGEG* |
| Ga0070685_107659312 | 3300005466 | Switchgrass Rhizosphere | LEIHATPVRYEKLDEGYLLGARISGMRDRDRELYDSYLEEIGE* |
| Ga0070707_1022583822 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IQATPVRYEKRDEGYLIGARISEMSERDRGLFKEYLGELTAS* |
| Ga0070699_1012785631 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IEILATPVRYEKLEKGYLIGARISEMSERNREMFEEYLREISED* |
| Ga0070684_1018409232 | 3300005535 | Corn Rhizosphere | AIELDLPNGLSIEILATPVRYEKLEKGYLIGARISEMSERNREMFEEYLREISED* |
| Ga0066697_107334151 | 3300005540 | Soil | QATPVRYEKQTEGYLIGAKISAMSDRNRELFEEYLRELSET* |
| Ga0070672_1016515862 | 3300005543 | Miscanthus Rhizosphere | ATPVRYEKREDGYLIGAQISEMSERDRELFEEYLQEIAKK* |
| Ga0070695_1002796113 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | YLLGAEGSMAIELDLPNGLSIEIQATPVRYEKREEGYLIGARISGMRERDRELFKEYLSELTPR* |
| Ga0070695_1010201891 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIELDLPNGGSVEIQATPVRHEKRDDGYLIGAQISEMSQRDRELFEEYLAELAGK* |
| Ga0066707_106717772 | 3300005556 | Soil | YEKQTEGYLIGAKISAMSDRNRELFEEYLRELSGT* |
| Ga0066703_105919441 | 3300005568 | Soil | GSMAIELDLPNGLSIEIQATPVRYQKLNEGYLIGARISEMTARDRELYLEYLGELAAG* |
| Ga0066708_100842811 | 3300005576 | Soil | QYLLGAEGSMAIELDLPNGLSIEIQATPVRYQKLDEGYLIGARISEMTARDRELYLEYLGELAAG* |
| Ga0066706_106595203 | 3300005598 | Soil | MSIELDLPNGLSIEIQATPVRYEKLEEGYLIGARISEMSERNREFYEEYLREIAEG* |
| Ga0070702_1012070211 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AEGSMAIELDLPNGLSIEFSATPVRYEKLEDGYLIGARISEMSERNREFFEAYLRQIAQG |
| Ga0068870_101943143 | 3300005840 | Miscanthus Rhizosphere | YEKLEKGYLIGARISEMSERNREMFEEYLREISED* |
| Ga0068863_1010872901 | 3300005841 | Switchgrass Rhizosphere | SLEIQATPVRYDKLDEGYLIGARISHMTERDRELYEEYLEEIGES* |
| Ga0068858_1002986701 | 3300005842 | Switchgrass Rhizosphere | VRYEKREDGYLIGAQISEMSERDRELFEEYLQEIAKK* |
| Ga0066659_109377071 | 3300006797 | Soil | QKLDEGYLIGARISEMTARDRELYLEYLGELAAG* |
| Ga0075428_1002314213 | 3300006844 | Populus Rhizosphere | MAIELDLPNGLSIEIHATPVRYEKLDEGYLIGARISDMSERNREMFEEYLREISGE* |
| Ga0075421_1021074071 | 3300006845 | Populus Rhizosphere | SMSIELDLPSGVSIEIEAMPVRYEKHDDGYLIGARITEITERDRELFDEYLRELG* |
| Ga0075433_101284191 | 3300006852 | Populus Rhizosphere | VSIEIQATPVRYDKRDDGYLIGAQISDMSPRDRELFEEYLREIGT* |
| Ga0079217_101326381 | 3300006876 | Agricultural Soil | LDLPNGVSIEIQAMPVRYEKRDDGYLIGARITDISKRDRELYDEYLRELS* |
| Ga0099794_103351081 | 3300007265 | Vadose Zone Soil | NGLSIEIQATPVRYEKLEEGYLIGVRISQMSERNREFFEEYLREIAEG* |
| Ga0066710_1039405842 | 3300009012 | Grasslands Soil | DEQYLMGSEGSMAIELDLPNGLSLEIQATPVRYEKLEEGYLIGTRISGMKARDRELFEEYLEEIGED |
| Ga0066710_1049053601 | 3300009012 | Grasslands Soil | GADGSMAIELDLPNGGSIEIHATPVRCQKHADGYLIGARISGMKNRDRELFNEYLQELAG |
| Ga0099830_113599101 | 3300009088 | Vadose Zone Soil | MAIELDLPSGLSIEIQATPVRYEKLEEGYLLGARSSEMSDRNRELFEEYLRELAGT* |
| Ga0099828_100900101 | 3300009089 | Vadose Zone Soil | LDLPNGLSIEIQATPVRYEKHAEGYLIGARISAMSDRNRELFEEYLRELSDES* |
| Ga0066709_1012161471 | 3300009137 | Grasslands Soil | GADGSMAIELDLPNGGSIEIHATPVRCQKHADGYLIGARISGMKNRDRELFNEYLQELAGQ* |
| Ga0066709_1041780961 | 3300009137 | Grasslands Soil | IELDLPNGLAIEIQATPVRSEKLEEGYMIGARISHMSERDRELFAEYLEEIGEG* |
| Ga0105242_106845271 | 3300009176 | Miscanthus Rhizosphere | RYEKLEEGYLIGARISGMKDRDRELYEEYLEEIGE* |
| Ga0105248_129744701 | 3300009177 | Switchgrass Rhizosphere | IHATPVRYEKLDEGYLIGARISEMSERNREMFEEYLREISEE* |
| Ga0126384_108617093 | 3300010046 | Tropical Forest Soil | IELDLPNGLSIEIHATPVSYEKLDEGYLIGARISEMSDRNRELYKEYLQEISEI* |
| Ga0126382_115135221 | 3300010047 | Tropical Forest Soil | EKLDEGYLIGARISEMSERNRAVFEEYLQEIGGE* |
| Ga0134088_101541541 | 3300010304 | Grasslands Soil | ELDLPNGGSIEIHATPVRYQKHADGYLIGARISGMKNRDRELFNEYLRELAGQ* |
| Ga0134063_105619662 | 3300010335 | Grasslands Soil | LSLEIQATPVRYEKRDEGYLIGARISQMTDRDRDLYEEYLRELTGQ* |
| Ga0134127_109517122 | 3300010399 | Terrestrial Soil | EIQATPVRYEKREEGYLIGARISGMRERDRGLFKEYLSELTPR* |
| Ga0134127_116243643 | 3300010399 | Terrestrial Soil | EIQATPVRYEKHDDGYLIGARISEMSERDRELYEEYLREIAGS* |
| Ga0134122_111885471 | 3300010400 | Terrestrial Soil | GVSLEIQATPVRYEKRDDGYLIGAQISQMSDRDRELYEEYLNDIAAGESNKTKS* |
| Ga0134121_105843163 | 3300010401 | Terrestrial Soil | EKLDEGYLIGARISEMSERNREMFEEYLREISEE* |
| Ga0134123_112023521 | 3300010403 | Terrestrial Soil | EKLEDGYLIGARISEMSARDRELYEEYLREIEAS* |
| Ga0137458_12389081 | 3300011436 | Soil | PVRYEKLDEGYLLGARISEMSERNRELFEEYLREVAGE* |
| Ga0137383_104956792 | 3300012199 | Vadose Zone Soil | GSMAIELDLPNGLSIEVQATPVRYEKLEEGYLIGARISEMSERNREFFEEYLREIAVR* |
| Ga0137399_109221462 | 3300012203 | Vadose Zone Soil | LDLPNGLSIEIQATPVRYEKRDEGYLIGARISEMSGRDRGLFKEYLSELAPG* |
| Ga0137386_100428721 | 3300012351 | Vadose Zone Soil | LSIEIQATPVRYQKLDEGYLIGARISEMTARDRELYLEYLGELAAG* |
| Ga0137369_102976593 | 3300012355 | Vadose Zone Soil | NGLSLEIQATPVRYERFDEGYLIGARISGMRERDRELYEEYLREIED* |
| Ga0137360_111980442 | 3300012361 | Vadose Zone Soil | LSIEIQATPVRYEKHAEGYLIGARISAMSDRNRELFEEYLRELANP* |
| Ga0137360_115563062 | 3300012361 | Vadose Zone Soil | GLSIEIQATPVRYEKHAEGYLIGARISAMSDRNRELFEEYLRELSET* |
| Ga0137358_103655282 | 3300012582 | Vadose Zone Soil | EGSMAIELDLPNGLSIEFQATPVRYEKLAEGYLIGARISEISERNREFFDEYLREIAAG* |
| Ga0137358_109439581 | 3300012582 | Vadose Zone Soil | NGLSLEIQATPVRCEKLEEGYVIGARISGMKARHRELFEEYLEEIGED* |
| Ga0137398_106182902 | 3300012683 | Vadose Zone Soil | EKLEEGYLIGARISRMKPRDRELFDEYLEEIGED* |
| Ga0137396_112175522 | 3300012918 | Vadose Zone Soil | SMAIELDLPNGLSIEIQATPVRYQKLEEGYLLGARISEMSDRNRELFEEYLRELTNA* |
| Ga0137359_100364697 | 3300012923 | Vadose Zone Soil | EFQATPVRYEKLAEGYLIGARISEMSERNREFFDEYLREIAGQ* |
| Ga0137419_102489603 | 3300012925 | Vadose Zone Soil | DLPNGLSIEIQATPVRYEKLEEGYLIGVRISQMSERNREFFEEYLREIAGGL* |
| Ga0137404_100557171 | 3300012929 | Vadose Zone Soil | DLPNGLSIEIQATPVRYEKRDEGYLIGARISRMSDRDRGLFEEYLGELTAS* |
| Ga0137410_109602991 | 3300012944 | Vadose Zone Soil | TEGSMAIELDLPNGLSIEIQATPVRYEKRDEGYLIGARISEMSGRDRGLFKEYLSELAPG |
| Ga0126375_104250561 | 3300012948 | Tropical Forest Soil | DLPNGLSLEIHATPVRYEKLDEGYLIGAQISGMKDRDRELYEQYLREIAGE* |
| Ga0164301_117886501 | 3300012960 | Soil | ATPVRYEKRDDGYLIGAQISEMSQRDRELFDEYLEEIAGG* |
| Ga0157378_102709151 | 3300013297 | Miscanthus Rhizosphere | MGGENSLAIELDLPNGLSLEIQATPVRYDKLDEGYLIGARISSMTDRDRGLYEEYLEEIGEG* |
| Ga0157375_104476122 | 3300013308 | Miscanthus Rhizosphere | LSLEIHATPVRYEKLEEGYLIGARISGMRDRDRELYEEYLEEIGEG* |
| Ga0157380_102175063 | 3300014326 | Switchgrass Rhizosphere | FRSKLDEGYLIGARISDMSERNREMFEEYLREISEE* |
| Ga0157380_123674601 | 3300014326 | Switchgrass Rhizosphere | MAIELDLPNGLSIEILATPVRYEKLEKGYLIGARISEMSERNREMFEEYLREISED* |
| Ga0137405_13515284 | 3300015053 | Vadose Zone Soil | VRYEKLEEGYLIGARISRMKPRDRELFDEYLEEIGED* |
| Ga0137418_106171302 | 3300015241 | Vadose Zone Soil | LDLPNGLSIEIQATPVRYEKLEEGYLIGARISGMSKRNREFFEEYLQEIAEG* |
| Ga0180075_10665331 | 3300015252 | Soil | EAMPVRYEKRDDGYLIGARITDISERDRELYDEYLRELPGQ* |
| Ga0132256_1003995174 | 3300015372 | Arabidopsis Rhizosphere | IELDLPNGWSVEIQATPVRHEKRDDGYVIGAQISEMSKRDRELFEEYLRELAKT* |
| Ga0132256_1021841922 | 3300015372 | Arabidopsis Rhizosphere | EIEATPVRYEKRADGYVIGAQISEMSERDRELFEEYLQEIAKR* |
| Ga0132255_1028657622 | 3300015374 | Arabidopsis Rhizosphere | EIEATLVRYEKREDGYVIGAQISEISERDRELFEEYLQEIAKR* |
| Ga0132255_1050716362 | 3300015374 | Arabidopsis Rhizosphere | LEIQATPVRYDKLDEGYLIGARISHMTDRDRGLYEEYLEEIGEG* |
| Ga0066667_112441702 | 3300018433 | Grasslands Soil | ANELDVPNGLAIGIRGTTGSSEKLEDGYMIGARISHMSERDRELFAEYLEEIGEG |
| Ga0193747_11304812 | 3300019885 | Soil | PNGLSIEIQATPVRYEKLEEGYLIGVRISQMSERNREFFEEYLREIAAG |
| Ga0210380_105962862 | 3300021082 | Groundwater Sediment | IELDLPNGLSIEILATPVRYEKLEKGYLIGARISDMSERNREMFEEYLREISEE |
| Ga0207688_102734721 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TPVRYEKRDDGYLIGAQISEMSERDREVFEEYLRELAV |
| Ga0207643_104983571 | 3300025908 | Miscanthus Rhizosphere | MAIELDLPNGLSIEILATPVRYEKLEKGYLIGARISEMSERNREMFEEYLREISED |
| Ga0207684_117484881 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SIEIQATPVRYEKRDEGYLIGARISEMSERDRGLFKEYLGELTAS |
| Ga0207687_109436412 | 3300025927 | Miscanthus Rhizosphere | GENSLAIELDLPNGLSLEIQATPVRYDKLDEGYLIGARISSMTDRDRELYEEYLEEIGEVTA |
| Ga0207703_102554271 | 3300026035 | Switchgrass Rhizosphere | NGGSIEIEATPVRYEKREDGYLIGAQISEMSERDRELFEEYLQEIAKK |
| Ga0207648_107398823 | 3300026089 | Miscanthus Rhizosphere | MSIELDLPNGVSLEIQATPVRYEKRDNGYLIGAQISQMSDRDRELYEEYLNDIAAGESNKTKS |
| Ga0207698_110527453 | 3300026142 | Corn Rhizosphere | HATPVRYEKLDEGYLIGARISEMSERNREMFEEYLREIAEE |
| Ga0209240_11934742 | 3300026304 | Grasslands Soil | EIQATPVRYEKLEEGYLLGARISEMSDRNRDLFEEYLRELSGA |
| Ga0257157_10350603 | 3300026496 | Soil | QATPVRYEKLPEGYLLGARISEMSDRTRELFEEYLRELSGES |
| Ga0209474_104460062 | 3300026550 | Soil | NGLSIEIQATPVRHEKLDEGYLIGARISDMSPHNRELFEEYLGELAEE |
| Ga0209648_107144932 | 3300026551 | Grasslands Soil | EIQATPVRYEKHAEGYLIGARISAMSDRNRELFEEYLRELSDES |
| Ga0209577_101245003 | 3300026552 | Soil | IELDLPNGLSIEIQATPVRYQKLGEGYLIGARISEMTDRDRELYLEYLGELAEG |
| Ga0209106_11596132 | 3300027616 | Forest Soil | NEGSMAIELDLPNGLSIEIHATPVRYEKLAEGYLIGARISEMTERNRELFEEYLRELEDE |
| Ga0209818_11393841 | 3300027637 | Agricultural Soil | IQAMPVRYEKRDDGYLIGARITDISKRDRELYDEYLRELS |
| Ga0209488_101410041 | 3300027903 | Vadose Zone Soil | SMAIELDLPNGFSIEFLATPVRYEKLEDGYLIGARISEMSERNREFFETYLRQIAEA |
| Ga0209488_111023262 | 3300027903 | Vadose Zone Soil | RYEKREEGYLIGARISDMSERNRELFEQYLRELGEPNP |
| Ga0209382_117925201 | 3300027909 | Populus Rhizosphere | SMSIELDLPSGVSIEIEAMPVRYEKHDDGYLIGARITEITERDRELFDEYLRELG |
| Ga0137415_112873841 | 3300028536 | Vadose Zone Soil | GLSIEIQATPVRYQKLDEGYLIGARISKMTDRDRELYLEYLGELA |
| Ga0310813_118545742 | 3300031716 | Soil | LLGGEGSMAIELDLPNGLSIEILATPVRYEKLEKGYLIGARISEMSERNREMFEEYLREISED |
| ⦗Top⦘ |