


| Basic Information | |
|---|---|
| Family ID | F091664 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMRR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.20 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.149 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07746 | LigA | 59.81 |
| PF07883 | Cupin_2 | 24.30 |
| PF06245 | DUF1015 | 3.74 |
| PF04238 | DUF420 | 0.93 |
| PF01594 | AI-2E_transport | 0.93 |
| PF13188 | PAS_8 | 0.93 |
| PF01547 | SBP_bac_1 | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF02317 | Octopine_DH | 0.93 |
| PF00528 | BPD_transp_1 | 0.93 |
| PF02738 | MoCoBD_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 3.74 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
| COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.65 % |
| Unclassified | root | N/A | 9.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01DUC7S | Not Available | 500 | Open in IMG/M |
| 3300000891|JGI10214J12806_10771124 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300000956|JGI10216J12902_117813660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1028 | Open in IMG/M |
| 3300005167|Ga0066672_10061749 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300005441|Ga0070700_101772175 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005446|Ga0066686_10048604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2579 | Open in IMG/M |
| 3300005447|Ga0066689_10694167 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005467|Ga0070706_100645920 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005467|Ga0070706_101589572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300005526|Ga0073909_10147872 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005713|Ga0066905_101974145 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005718|Ga0068866_10300102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1003 | Open in IMG/M |
| 3300005764|Ga0066903_108528773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300006797|Ga0066659_11134671 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006800|Ga0066660_10556774 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006800|Ga0066660_11514286 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006806|Ga0079220_10399874 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300006853|Ga0075420_101418666 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006871|Ga0075434_100150017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2351 | Open in IMG/M |
| 3300006954|Ga0079219_11252682 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300007258|Ga0099793_10455575 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300009090|Ga0099827_11658174 | Not Available | 557 | Open in IMG/M |
| 3300009092|Ga0105250_10096460 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300009093|Ga0105240_10178337 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300009148|Ga0105243_12466792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300009174|Ga0105241_10692613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 929 | Open in IMG/M |
| 3300009799|Ga0105075_1021194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 683 | Open in IMG/M |
| 3300010166|Ga0126306_11031576 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010358|Ga0126370_11252711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
| 3300010359|Ga0126376_12006105 | Not Available | 620 | Open in IMG/M |
| 3300010366|Ga0126379_12658195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300010399|Ga0134127_12300511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
| 3300012203|Ga0137399_11684670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300012209|Ga0137379_11678649 | Not Available | 532 | Open in IMG/M |
| 3300012285|Ga0137370_10985043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300012357|Ga0137384_10219312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1590 | Open in IMG/M |
| 3300012359|Ga0137385_11324639 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300012670|Ga0137335_1014326 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012671|Ga0137318_1019568 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012922|Ga0137394_10801094 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012930|Ga0137407_10400939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1270 | Open in IMG/M |
| 3300012972|Ga0134077_10290142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
| 3300013306|Ga0163162_11138509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300014154|Ga0134075_10380833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
| 3300014308|Ga0075354_1116634 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014324|Ga0075352_1052766 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300014326|Ga0157380_11964529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300014881|Ga0180094_1037730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300015245|Ga0137409_10735164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 822 | Open in IMG/M |
| 3300015262|Ga0182007_10150351 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300015358|Ga0134089_10040004 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300015372|Ga0132256_100103811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2773 | Open in IMG/M |
| 3300015372|Ga0132256_100947366 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300017656|Ga0134112_10006487 | All Organisms → cellular organisms → Bacteria | 3765 | Open in IMG/M |
| 3300017659|Ga0134083_10006819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3693 | Open in IMG/M |
| 3300017792|Ga0163161_10904830 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300018076|Ga0184609_10127408 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300018078|Ga0184612_10151677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1212 | Open in IMG/M |
| 3300018078|Ga0184612_10165757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1154 | Open in IMG/M |
| 3300018079|Ga0184627_10141867 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300018084|Ga0184629_10303850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 840 | Open in IMG/M |
| 3300018089|Ga0187774_10884513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300018469|Ga0190270_12598145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300019789|Ga0137408_1149902 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300020004|Ga0193755_1132363 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300020202|Ga0196964_10150833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1053 | Open in IMG/M |
| 3300022694|Ga0222623_10063091 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300025160|Ga0209109_10231011 | Not Available | 903 | Open in IMG/M |
| 3300025910|Ga0207684_10014468 | All Organisms → cellular organisms → Bacteria | 6802 | Open in IMG/M |
| 3300025910|Ga0207684_11553917 | Not Available | 537 | Open in IMG/M |
| 3300025913|Ga0207695_10567570 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300025917|Ga0207660_11519936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300025938|Ga0207704_10461582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1016 | Open in IMG/M |
| 3300025961|Ga0207712_11952519 | Not Available | 525 | Open in IMG/M |
| 3300025965|Ga0210090_1020369 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300025981|Ga0207640_10819858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300026075|Ga0207708_11179086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300026118|Ga0207675_100815000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300026361|Ga0257176_1027461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 847 | Open in IMG/M |
| 3300026480|Ga0257177_1007681 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1371 | Open in IMG/M |
| 3300027209|Ga0209875_1049453 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027526|Ga0209968_1045611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300027671|Ga0209588_1218033 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300027787|Ga0209074_10082044 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300027874|Ga0209465_10009280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4353 | Open in IMG/M |
| 3300027909|Ga0209382_12276845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300027954|Ga0209859_1071178 | Not Available | 553 | Open in IMG/M |
| 3300028381|Ga0268264_12582835 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300028536|Ga0137415_10877373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
| 3300028809|Ga0247824_10615521 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300028812|Ga0247825_10122628 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1770 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10014058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2057 | Open in IMG/M |
| 3300031231|Ga0170824_103596388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3213 | Open in IMG/M |
| 3300031747|Ga0318502_10023157 | All Organisms → cellular organisms → Bacteria | 3042 | Open in IMG/M |
| 3300031770|Ga0318521_10057556 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300031781|Ga0318547_10158789 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300031949|Ga0214473_11381853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
| 3300032041|Ga0318549_10130378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1111 | Open in IMG/M |
| 3300032174|Ga0307470_11655618 | Not Available | 537 | Open in IMG/M |
| 3300032180|Ga0307471_100538370 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300032180|Ga0307471_103122829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300032180|Ga0307471_104127825 | Not Available | 513 | Open in IMG/M |
| 3300032205|Ga0307472_100815143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 854 | Open in IMG/M |
| 3300032274|Ga0316203_1075342 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300033500|Ga0326730_1074067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300033811|Ga0364924_150612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300034417|Ga0364941_022070 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012670 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2 | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_02882560 | 2170459005 | Grass Soil | MATIVAAMAMTHSPGLTGWFDAAPKGQQEEALRAT |
| JGI10214J12806_107711243 | 3300000891 | Soil | MARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTEMRERL |
| JGI10216J12902_1178136601 | 3300000956 | Soil | MARVVAAMAMTHSPGLTGWFTRASREYQELALQTTAEMR |
| Ga0066672_100617494 | 3300005167 | Soil | MAEIVAAMAMTHSPGLTGWFTRASREYQQLALQATAVMRRRLEAARP |
| Ga0070700_1017721751 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEIVAAMAMTHSPGLTGWFTRASQDYQQQALTALAEMRR |
| Ga0066686_100486044 | 3300005446 | Soil | VARVVAVMAMTHSPGLTGWFTRASREYQQLALQATAEMRR |
| Ga0066689_106941671 | 3300005447 | Soil | MAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMRR |
| Ga0070706_1006459203 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MATIVSAMAMTHSPGLTGWFERASNDYQERALRAIGEMRERL |
| Ga0070706_1015895721 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MASIVCAMAMTHSPGLTGWFASASEEYQALALGALGEMRQRLHAARPDVI |
| Ga0073909_101478721 | 3300005526 | Surface Soil | VAEIVAAMAMTHSPGLTGWFTRASEDYQHQALTALGEMRRR |
| Ga0066905_1019741453 | 3300005713 | Tropical Forest Soil | MSSIVAAMAMSHSPGLTGWFDRAPAEQQKEARRALTEL |
| Ga0068866_103001021 | 3300005718 | Miscanthus Rhizosphere | MARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTEMRERLA |
| Ga0066903_1085287731 | 3300005764 | Tropical Forest Soil | MAQIVAAMAMTHSPGLTGWFDRAPKDYQEQALRALGEM |
| Ga0066659_111346713 | 3300006797 | Soil | VAEIVAAMAMTHSPGLTGWFTRASEDYQRQALQATAEMR |
| Ga0066660_105567741 | 3300006800 | Soil | VARIVAAMAMTHSPGLTGWFTRAPEAYQRLALEAT |
| Ga0066660_115142861 | 3300006800 | Soil | MAEIVAAMAMTHSPGLTGWFSRASRDYQELALQATAEM |
| Ga0079220_103998741 | 3300006806 | Agricultural Soil | VAEVVTALAMTHSPGLTGWFTRASEEYQRLALQATAEM |
| Ga0075420_1014186663 | 3300006853 | Populus Rhizosphere | VATIVAAMAMTHSPGLTGWFERAPLQQQLLAKKAMDEMRWRLEA |
| Ga0075434_1001500175 | 3300006871 | Populus Rhizosphere | VAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATAEMRRRLV |
| Ga0079219_112526821 | 3300006954 | Agricultural Soil | MAQAVAAMALTHSPGLTGWFDRAPEEFQQQALGATTEMRRRLEA |
| Ga0099793_104555753 | 3300007258 | Vadose Zone Soil | VAEIVAAMAMTHSPGLTGWFDRASEEHQQLALGATAEMRRRLEAA |
| Ga0099827_116581741 | 3300009090 | Vadose Zone Soil | MAEIVCAMAMTHSPGLTGWFASASAEYQALALGALGEMRQRL |
| Ga0105250_100964601 | 3300009092 | Switchgrass Rhizosphere | MARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTE |
| Ga0105240_101783375 | 3300009093 | Corn Rhizosphere | VAQVVAAMALTHSPGLTGWFDRAPENQRREARGALDTMRERL |
| Ga0105243_124667923 | 3300009148 | Miscanthus Rhizosphere | MAQIVAAMAMTHSPGMTGWFTQAPEDQQELTLRATAALRERLDA |
| Ga0105241_106926133 | 3300009174 | Corn Rhizosphere | MARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTEM |
| Ga0105075_10211941 | 3300009799 | Groundwater Sand | MARVVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMR |
| Ga0126306_110315761 | 3300010166 | Serpentine Soil | MAMTHSPGTTGWFDRAPQSHQTLALQAMTEMRERLA |
| Ga0126370_112527111 | 3300010358 | Tropical Forest Soil | MAEIVAAMAMTHSPGLTGWFTRASQDYQQQALQATAEMRRRLVAA |
| Ga0126376_120061051 | 3300010359 | Tropical Forest Soil | MAQIVAAMAMTHSPGLTGWFDRAPKDYQEQALRALGEMRERLAR |
| Ga0126379_126581951 | 3300010366 | Tropical Forest Soil | MARVVAAMAMTHSPGLTGWFDRAPMHQQLLAKKAMDEMRWRLEAAKPD |
| Ga0134127_123005111 | 3300010399 | Terrestrial Soil | VAEVVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRRRLEA |
| Ga0137399_116846701 | 3300012203 | Vadose Zone Soil | MARVVAAMAMTHSPGLTGWFTRASREYQELALQATAEMR |
| Ga0137379_116786491 | 3300012209 | Vadose Zone Soil | MAKIVTAMAMTHSPGLTGWFDRAPMQQQLLAKKALDE |
| Ga0137370_109850431 | 3300012285 | Vadose Zone Soil | VSVADIVAAMAMTHSPGLTGWLDRAPEEFQQQALAATAEMR |
| Ga0137384_102193124 | 3300012357 | Vadose Zone Soil | VAKIVAAMAMTHSPGLTGWFDRAPKDQQAQALQAL |
| Ga0137385_113246392 | 3300012359 | Vadose Zone Soil | MAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATA |
| Ga0137335_10143263 | 3300012670 | Soil | VAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQAT |
| Ga0137318_10195683 | 3300012671 | Soil | MARIVAAMAMTHSPGLTGWFDRAPEDQRLEARRAPDEAREGLRGDRHGATLRWR |
| Ga0137394_108010943 | 3300012922 | Vadose Zone Soil | VATIVSAMAMTHSPGLTGWFERASTDYRERALRAIGEMRERLARSRP |
| Ga0137407_104009394 | 3300012930 | Vadose Zone Soil | VAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRRRLEA |
| Ga0134077_102901423 | 3300012972 | Grasslands Soil | MAEVVAAMAMTHSPGLTGWFDRASEEHQQLALGATASAS |
| Ga0163162_111385093 | 3300013306 | Switchgrass Rhizosphere | MAQIVAAMAMTHSPGLTGWFDRASKEYQEQALRAMTEMRERLAAAR |
| Ga0134075_103808333 | 3300014154 | Grasslands Soil | MAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATA |
| Ga0075354_11166341 | 3300014308 | Natural And Restored Wetlands | VARIVTAMAMTHSPGLTGWFDRAPEDQRLAARRALDEMRE |
| Ga0075352_10527662 | 3300014324 | Natural And Restored Wetlands | MSHVVAAMAMTHGPGLTGWFDRAPRAYQEMTLHATAEMRRRL |
| Ga0157380_119645293 | 3300014326 | Switchgrass Rhizosphere | MAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATAEMRRR |
| Ga0180094_10377303 | 3300014881 | Soil | MARIVAAMAMTHSPGLTGWFDRAPEDQQIEARRALDEMRARRRAARPASSLRCG* |
| Ga0137409_107351644 | 3300015245 | Vadose Zone Soil | MARLVGAMAMTHSPGLTGWFTRASQEYQQLALQATA |
| Ga0182007_101503511 | 3300015262 | Rhizosphere | VAQVVAAMALTHSPGLTGWFDRAPENQRREARGALDTMRE |
| Ga0134089_100400041 | 3300015358 | Grasslands Soil | MAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMRRR |
| Ga0132256_1001038116 | 3300015372 | Arabidopsis Rhizosphere | MAQIVAAMAMTHSPGLTGWFDRASKEYQEQALRAMTEMRE |
| Ga0132256_1009473661 | 3300015372 | Arabidopsis Rhizosphere | MAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATAEMRRRLV |
| Ga0134112_100064875 | 3300017656 | Grasslands Soil | MARIVAAMAITHSPGLTGWFTRAPEAYQQLVLGATA |
| Ga0134083_100068195 | 3300017659 | Grasslands Soil | MARIVAAMAMTHSPGLTGWFTRAPEAYQQLVLGATA |
| Ga0163161_109048301 | 3300017792 | Switchgrass Rhizosphere | MAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATLALSRIG |
| Ga0184609_101274081 | 3300018076 | Groundwater Sediment | MAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEM |
| Ga0184612_101516774 | 3300018078 | Groundwater Sediment | VAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRRRLE |
| Ga0184612_101657571 | 3300018078 | Groundwater Sediment | MAEIVAAMAMTHSPGLTGWFTRASESDQGLALQAT |
| Ga0184627_101418671 | 3300018079 | Groundwater Sediment | MATIVAALAMTHAPGLTGWFDRAPTEHQQEARRAL |
| Ga0184629_103038501 | 3300018084 | Groundwater Sediment | MARIVAAMAMTHSPGLTGWFDRAPQSHQTQSLQAM |
| Ga0187774_108845133 | 3300018089 | Tropical Peatland | VAEVVAAMAMTHSPGLTGWFTRASEDYQQQALRATA |
| Ga0190270_125981451 | 3300018469 | Soil | MAQIVAAMAMTHSPGMTGWLTQAPKDQRELALRATAALRE |
| Ga0137408_11499021 | 3300019789 | Vadose Zone Soil | MAEIVAAMAMTHSPGLTGWFSQASQDYQQQALHATA |
| Ga0193755_11323631 | 3300020004 | Soil | VARIVAAMAMTHSPGLTGWFDRAPEDQQIEARRALDEMRERL |
| Ga0196964_101508331 | 3300020202 | Soil | MATIVAAMAMTHSPGLTGWFERAPMQQQLLARKAM |
| Ga0222623_100630914 | 3300022694 | Groundwater Sediment | VAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATSEMRRRLEATRPD |
| Ga0209109_102310111 | 3300025160 | Soil | VARVVAAMAMTHAPGLTGWFDQAPEDQRVEARRAL |
| Ga0207684_100144681 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIVAAMAMTHSPGLTGWFARAPEEHQALARRAMD |
| Ga0207684_115539172 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MASIVCAMAMTHSPGLTGWFASASEEYQALALGALGEMRQRL |
| Ga0207695_105675703 | 3300025913 | Corn Rhizosphere | MALTHSPGLTGWFDRAPENQRREARGALDTMRERLRAA |
| Ga0207660_115199361 | 3300025917 | Corn Rhizosphere | MAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATA |
| Ga0207704_104615824 | 3300025938 | Miscanthus Rhizosphere | MAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQAT |
| Ga0207712_119525191 | 3300025961 | Switchgrass Rhizosphere | VARIVAAMAMTHSPGLTGWFERAPEDQQVEARRALDEMRER |
| Ga0210090_10203693 | 3300025965 | Natural And Restored Wetlands | VARIVTAMAMTHSPGLTGWFDRAPEDQRLAARRALDEMR |
| Ga0207640_108198581 | 3300025981 | Corn Rhizosphere | VARIVAAMAMTHSPGLTGWFERAPEDQQVEARRALDEMRERLRAARPD |
| Ga0207708_111790862 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEIVAAMAMTHSPGLTGWFTRASEDYQHQALTALAE |
| Ga0207675_1008150003 | 3300026118 | Switchgrass Rhizosphere | MAQIVAAMAMTHSPGMTGWFTQAPEDQQELTLRATAALRERLDAARP |
| Ga0257176_10274613 | 3300026361 | Soil | MARIVAAMAMTHSPGLTGWFDRAPKDQQAQALQAL |
| Ga0257177_10076815 | 3300026480 | Soil | MAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRR |
| Ga0209875_10494532 | 3300027209 | Groundwater Sand | VAEIVAAMAMTHSPGLTGWFDRASEEYQQLALGATAEMRRRL |
| Ga0209968_10456111 | 3300027526 | Arabidopsis Thaliana Rhizosphere | VAEIVAAMAMTHSPGLTGWFDRASVEYQQLALSATAEMRPR |
| Ga0209588_12180333 | 3300027671 | Vadose Zone Soil | MAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRRRL |
| Ga0209074_100820441 | 3300027787 | Agricultural Soil | MALTHSPGLTGWFDRALENQRREARGALDTMRERLRAARPDVILLF |
| Ga0209465_100092806 | 3300027874 | Tropical Forest Soil | MARIVAAMAMTHSPGLTGWFDRAPKDYQEQALRALGEMRER |
| Ga0209382_122768452 | 3300027909 | Populus Rhizosphere | MADIVAAMAMTHSPGLTGWFDRASEEYQQLALNATAEMR |
| Ga0209859_10711782 | 3300027954 | Groundwater Sand | MAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRRRLEAAEQSREPR |
| Ga0268264_125828351 | 3300028381 | Switchgrass Rhizosphere | MARVVAAMAMTHSPGLTGWFTRASREYQELALQATAEMRRRLEA |
| Ga0137415_108773733 | 3300028536 | Vadose Zone Soil | MAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQAT |
| Ga0247824_106155213 | 3300028809 | Soil | VAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQALVL |
| Ga0247825_101226281 | 3300028812 | Soil | MADIVAAMAMTHSPGLTGWFDRASEEYQQLALNATAEM |
| (restricted) Ga0255310_100140581 | 3300031197 | Sandy Soil | VAQLVAAMAMTHSPGLTGWFTRASQEYQQLALQAT |
| Ga0170824_1035963887 | 3300031231 | Forest Soil | MAQIVAAMAMTHSPGLTGWFDRASKEYQEQALRAMTEMRERLAAARPPAR |
| Ga0318502_100231571 | 3300031747 | Soil | MAEIVAAMAMTHSPGLTGWFSRASGDHQRLALEATAEMRR |
| Ga0318521_100575561 | 3300031770 | Soil | MAEIVAAMAMTHSPGLTGWFTRASQDYQQQALQATAEMR |
| Ga0318547_101587891 | 3300031781 | Soil | MAEIVAAMAMTHSPGLTGWFSRASEDYQRLALEATAEMRRRL |
| Ga0214473_113818533 | 3300031949 | Soil | VAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRQRLEA |
| Ga0318549_101303781 | 3300032041 | Soil | MAEIVAAMAMTHSPGLTGWFTRASQDYQQQALQAT |
| Ga0307470_116556181 | 3300032174 | Hardwood Forest Soil | MAEIVAAMAMTHSPGLTGWFDRAPKRHQEQALRAMGEMR |
| Ga0307471_1005383703 | 3300032180 | Hardwood Forest Soil | MAMTHSPGLTGWFKSASEDYQALALGALGEMRQRLQAARPDVIV |
| Ga0307471_1031228291 | 3300032180 | Hardwood Forest Soil | VAEIVAAMAMTHSPGLTGWFTRASEDYQHQALTALAEMRR |
| Ga0307471_1041278251 | 3300032180 | Hardwood Forest Soil | MAKIVTAMAMTHSPGLTGWFDRAPMQQQLLAKKALDEM |
| Ga0307472_1008151431 | 3300032205 | Hardwood Forest Soil | MAEIVAAMAMTHGPGLTGWFDAAPKEYQELTLRATDEMRRRL |
| Ga0316203_10753421 | 3300032274 | Microbial Mat | MAKIVAAMAMTHSPGLAGWFESAPAEEQQMALDAFSDM |
| Ga0326730_10740671 | 3300033500 | Peat Soil | MAQIVAAMAMTHSPGLTGWFDRAPKDYQEQALRAMGEMRER |
| Ga0364924_150612_1_144 | 3300033811 | Sediment | MAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRRRLEAARPD |
| Ga0364941_022070_1159_1302 | 3300034417 | Sediment | MARVVAAMAMTHSPGLTGWFTRASREYQELALQATAEMRRRLEAARPD |
| ⦗Top⦘ |