


| Basic Information | |
|---|---|
| Family ID | F091649 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.03 % |
| % of genes near scaffold ends (potentially truncated) | 31.78 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 46 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.028 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion (31.776 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.112 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 65.96% β-sheet: 0.00% Coil/Unstructured: 34.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF10686 | YAcAr | 18.69 |
| PF00136 | DNA_pol_B | 2.80 |
| PF03104 | DNA_pol_B_exo1 | 1.87 |
| PF03237 | Terminase_6N | 1.87 |
| PF01555 | N6_N4_Mtase | 0.93 |
| PF13479 | AAA_24 | 0.93 |
| PF00961 | LAGLIDADG_1 | 0.93 |
| PF00303 | Thymidylat_synt | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 4.67 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.93 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.93 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.03 % |
| All Organisms | root | All Organisms | 28.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111018|Meso_c1163146 | Not Available | 538 | Open in IMG/M |
| 2209111018|Meso_c149299 | Not Available | 512 | Open in IMG/M |
| 2209111018|Meso_c393587 | Not Available | 542 | Open in IMG/M |
| 2209111018|Meso_c507244 | Not Available | 533 | Open in IMG/M |
| 2209111018|Meso_c545372 | Not Available | 532 | Open in IMG/M |
| 2209111018|Meso_c818043 | Not Available | 518 | Open in IMG/M |
| 3300000510|Foulum_1005472 | All Organisms → Viruses → Predicted Viral | 1567 | Open in IMG/M |
| 3300000510|Foulum_1006733 | All Organisms → cellular organisms → Archaea | 2066 | Open in IMG/M |
| 3300001975|Draft_10149299 | Not Available | 516 | Open in IMG/M |
| 3300001975|Draft_10271015 | Not Available | 524 | Open in IMG/M |
| 3300001975|Draft_10421475 | Not Available | 512 | Open in IMG/M |
| 3300001975|Draft_10507244 | Not Available | 535 | Open in IMG/M |
| 3300001975|Draft_10545372 | Not Available | 536 | Open in IMG/M |
| 3300001975|Draft_10818043 | Not Available | 517 | Open in IMG/M |
| 3300002163|JGI24707J26582_10046031 | All Organisms → cellular organisms → Archaea | 1655 | Open in IMG/M |
| 3300002163|JGI24707J26582_10046747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 1635 | Open in IMG/M |
| 3300002163|JGI24707J26582_10067999 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300002164|JGI24708J26588_10115623 | Not Available | 776 | Open in IMG/M |
| 3300002166|JGI24713J26584_10006472 | Not Available | 6391 | Open in IMG/M |
| 3300002166|JGI24713J26584_10095648 | Not Available | 587 | Open in IMG/M |
| 3300002167|JGI24714J26587_10041266 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300002167|JGI24714J26587_10070636 | Not Available | 798 | Open in IMG/M |
| 3300002167|JGI24714J26587_10084435 | Not Available | 686 | Open in IMG/M |
| 3300002168|JGI24712J26585_10105017 | Not Available | 939 | Open in IMG/M |
| 3300002170|JGI24711J26586_10116004 | Not Available | 705 | Open in IMG/M |
| 3300002170|JGI24711J26586_10138749 | Not Available | 617 | Open in IMG/M |
| 3300002170|JGI24711J26586_10141731 | Not Available | 608 | Open in IMG/M |
| 3300002173|JGI24709J26583_10085566 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300002173|JGI24709J26583_10095482 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300002173|JGI24709J26583_10126694 | Not Available | 772 | Open in IMG/M |
| 3300002173|JGI24709J26583_10205207 | Not Available | 529 | Open in IMG/M |
| 3300002174|JGI24710J26742_10108064 | Not Available | 949 | Open in IMG/M |
| 3300002174|JGI24710J26742_10129710 | Not Available | 812 | Open in IMG/M |
| 3300002174|JGI24710J26742_10189519 | Not Available | 598 | Open in IMG/M |
| 3300002174|JGI24710J26742_10202815 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300002174|JGI24710J26742_10217533 | Not Available | 538 | Open in IMG/M |
| 3300002293|JGI24504J29685_1025540 | Not Available | 520 | Open in IMG/M |
| 3300002377|JGI24500J29687_10026911 | Not Available | 965 | Open in IMG/M |
| 3300002377|JGI24500J29687_10037456 | Not Available | 511 | Open in IMG/M |
| 3300002378|JGI24502J29692_10115183 | Not Available | 734 | Open in IMG/M |
| 3300002392|JGI24503J29689_10034695 | Not Available | 1762 | Open in IMG/M |
| 3300002392|JGI24503J29689_10056532 | Not Available | 853 | Open in IMG/M |
| 3300002392|JGI24503J29689_10062567 | Not Available | 604 | Open in IMG/M |
| 3300002392|JGI24503J29689_10111409 | Not Available | 603 | Open in IMG/M |
| 3300002898|draft_10338613 | Not Available | 740 | Open in IMG/M |
| 3300003667|LSCM3L_1056352 | Not Available | 542 | Open in IMG/M |
| 3300005835|Ga0078910_108703 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300005835|Ga0078910_126523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 1076 | Open in IMG/M |
| 3300006801|Ga0079223_10401139 | Not Available | 851 | Open in IMG/M |
| 3300006805|Ga0075464_10391155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 844 | Open in IMG/M |
| 3300009095|Ga0079224_101247616 | Not Available | 1058 | Open in IMG/M |
| 3300009647|Ga0123326_1187846 | Not Available | 639 | Open in IMG/M |
| 3300009657|Ga0116179_1159910 | Not Available | 783 | Open in IMG/M |
| 3300009658|Ga0116188_1074500 | Not Available | 1427 | Open in IMG/M |
| 3300009666|Ga0116182_1075091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 1785 | Open in IMG/M |
| 3300009667|Ga0116147_1010800 | Not Available | 6414 | Open in IMG/M |
| 3300009668|Ga0116180_1184057 | Not Available | 823 | Open in IMG/M |
| 3300009670|Ga0116183_1089396 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 1663 | Open in IMG/M |
| 3300009671|Ga0123334_1083408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus polymyxa | 1668 | Open in IMG/M |
| 3300009674|Ga0116173_1126697 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300009680|Ga0123335_1217093 | Not Available | 973 | Open in IMG/M |
| 3300009680|Ga0123335_1487350 | Not Available | 554 | Open in IMG/M |
| 3300009685|Ga0116142_10386648 | Not Available | 676 | Open in IMG/M |
| 3300009687|Ga0116144_10422447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 665 | Open in IMG/M |
| 3300009687|Ga0116144_10657230 | Not Available | 505 | Open in IMG/M |
| 3300009690|Ga0116143_10142666 | Not Available | 1334 | Open in IMG/M |
| 3300009780|Ga0116156_10135249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 1387 | Open in IMG/M |
| 3300010286|Ga0134092_1000193 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 64755 | Open in IMG/M |
| 3300010340|Ga0116250_10060873 | All Organisms → cellular organisms → Archaea | 2661 | Open in IMG/M |
| 3300010356|Ga0116237_11588131 | Not Available | 535 | Open in IMG/M |
| 3300010365|Ga0116251_10254689 | Not Available | 1021 | Open in IMG/M |
| 3300014203|Ga0172378_10362865 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300014203|Ga0172378_11048706 | Not Available | 581 | Open in IMG/M |
| 3300014204|Ga0172381_10046328 | Not Available | 3763 | Open in IMG/M |
| 3300014204|Ga0172381_10692367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus polymyxa | 772 | Open in IMG/M |
| 3300014206|Ga0172377_10340475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 1259 | Open in IMG/M |
| 3300014206|Ga0172377_11016276 | Not Available | 639 | Open in IMG/M |
| 3300014206|Ga0172377_11478713 | Not Available | 509 | Open in IMG/M |
| 3300025618|Ga0208693_1011097 | Not Available | 4412 | Open in IMG/M |
| 3300025629|Ga0208824_1114480 | Not Available | 778 | Open in IMG/M |
| 3300025638|Ga0208198_1102252 | Not Available | 847 | Open in IMG/M |
| 3300025689|Ga0209407_1043151 | All Organisms → cellular organisms → Archaea | 1879 | Open in IMG/M |
| 3300025708|Ga0209201_1108223 | Not Available | 985 | Open in IMG/M |
| 3300025896|Ga0208916_10466996 | Not Available | 550 | Open in IMG/M |
| 3300026290|Ga0209510_1054632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus polymyxa | 1671 | Open in IMG/M |
| 3300027510|Ga0209537_1004062 | All Organisms → cellular organisms → Archaea | 12817 | Open in IMG/M |
| 3300027510|Ga0209537_1048509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1345 | Open in IMG/M |
| 3300027510|Ga0209537_1090703 | Not Available | 742 | Open in IMG/M |
| 3300027510|Ga0209537_1094636 | Not Available | 713 | Open in IMG/M |
| 3300028601|Ga0265295_1043365 | All Organisms → Viruses → Predicted Viral | 2895 | Open in IMG/M |
| 3300028602|Ga0265294_10122551 | Not Available | 2023 | Open in IMG/M |
| 3300028602|Ga0265294_10371138 | Not Available | 917 | Open in IMG/M |
| 3300028602|Ga0265294_10372242 | Not Available | 915 | Open in IMG/M |
| 3300028602|Ga0265294_10385068 | Not Available | 893 | Open in IMG/M |
| 3300028602|Ga0265294_10411651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 851 | Open in IMG/M |
| 3300028602|Ga0265294_10419283 | Not Available | 840 | Open in IMG/M |
| 3300028602|Ga0265294_10452824 | Not Available | 794 | Open in IMG/M |
| 3300028602|Ga0265294_10502934 | Not Available | 736 | Open in IMG/M |
| 3300028602|Ga0265294_10556158 | Not Available | 684 | Open in IMG/M |
| 3300028602|Ga0265294_10574252 | Not Available | 668 | Open in IMG/M |
| 3300028603|Ga0265293_10103299 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300028603|Ga0265293_10250070 | Not Available | 1174 | Open in IMG/M |
| 3300028603|Ga0265293_10255351 | Not Available | 1156 | Open in IMG/M |
| 3300028603|Ga0265293_10696776 | Not Available | 545 | Open in IMG/M |
| 3300029822|Ga0134854_1046523 | Not Available | 999 | Open in IMG/M |
| 3300029822|Ga0134854_1046574 | Not Available | 998 | Open in IMG/M |
| 3300029825|Ga0134835_1007159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 7103 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 31.78% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 18.69% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 11.21% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 9.35% |
| Solid Waste From Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor | 5.61% |
| Biogas Fermenter | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter | 5.61% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 4.67% |
| Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 2.80% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 1.87% |
| Anaerobic Digester | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester | 1.87% |
| Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor | 1.87% |
| Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 0.93% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 0.93% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111018 | Mesophilic bioreactor microbial communities at Bielefeld, Germany | Engineered | Open in IMG/M |
| 3300000510 | Anaerobic digester microbial communities from Northern Denmark, sample from Foulum manure | Engineered | Open in IMG/M |
| 3300001975 | Biogas fermenter microbial communities from the University of Hamburg, Germany | Engineered | Open in IMG/M |
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300002164 | Biogas fermentation microbial communities from Germany - Plant 1 DNA2 | Engineered | Open in IMG/M |
| 3300002166 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 | Engineered | Open in IMG/M |
| 3300002167 | Biogas fermentation microbial communities from Germany - Plant 4 DNA2 | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002293 | Biogas fermentation microbial communities from Germany - Plant 4 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002377 | Biogas fermentation microbial communities from Germany - Plant 2 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002378 | Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002392 | Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300003667 | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) | Environmental | Open in IMG/M |
| 3300005835 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads | Engineered | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009668 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300010286 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 3_6_20_6_A3 metaG | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300025618 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027510 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes) | Engineered | Open in IMG/M |
| 3300028601 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilm | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300029822 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T | Engineered | Open in IMG/M |
| 3300029825 | Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Meso_11631462 | 2209111018 | Solid Waste From Bioreactor | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKN |
| Meso_1492992 | 2209111018 | Solid Waste From Bioreactor | MMPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG |
| Meso_3935871 | 2209111018 | Solid Waste From Bioreactor | MPTXDDPDYELETNGKENGICDPYEKSIREFKEEFDGIEKKLNRQEDELCV |
| Meso_5072442 | 2209111018 | Solid Waste From Bioreactor | MPVYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIERN |
| Meso_5453721 | 2209111018 | Solid Waste From Bioreactor | QMVKKNGICDPYEESIREFKEEFERIEKEFIEEYKRIEKKLKQTGG |
| Meso_8180431 | 2209111018 | Solid Waste From Bioreactor | MPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEIERIEKEFIEEYKRIEKKLKQTGG |
| Foulum_10054727 | 3300000510 | Anaerobic Digester | MPTYDDPDYEWKQMVKKNGICDPYEKSLKEFKEEFERIEKKLKQTGR* |
| Foulum_10067331 | 3300000510 | Anaerobic Digester | MMPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG* |
| Draft_101492992 | 3300001975 | Biogas Fermenter | MMPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| Draft_102710152 | 3300001975 | Biogas Fermenter | MMIRIMNRKQIGKEECICDPYEESIREFKEEFERIEKKLKQTGG* |
| Draft_104214753 | 3300001975 | Biogas Fermenter | MPTYDDQDYEWKQMVKKNGICDPYEKSIREFKEEFERIERIKTDR* |
| Draft_105072442 | 3300001975 | Biogas Fermenter | MPVYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIERN* |
| Draft_105453721 | 3300001975 | Biogas Fermenter | QQMVKKNGICDPYEESIREFKEEFERIEKEFIEEYKRIEKKLKQTGG* |
| Draft_108180431 | 3300001975 | Biogas Fermenter | SMPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEIERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24707J26582_100460314 | 3300002163 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGVCDPYEKSIREFKEEFERIEKEFIEEYKRIEKKLKQTGG*IMRIIIAG |
| JGI24707J26582_100467471 | 3300002163 | Biogas Fermentantion | KQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG* |
| JGI24707J26582_100679993 | 3300002163 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEYERIEKKLKQTGR* |
| JGI24708J26588_101156231 | 3300002164 | Biogas Fermentantion | MMMPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKEFIEEYKRIEKKLKQTGG |
| JGI24713J26584_100064727 | 3300002166 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFEHIEKKLKQTGG* |
| JGI24713J26584_100956482 | 3300002166 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFIEEFERIEKKLKQTGG* |
| JGI24714J26587_100412661 | 3300002167 | Biogas Fermentantion | MPVYDDPDYEWKQMXKKNGICDPYEKSIREFKEEIERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24714J26587_100706362 | 3300002167 | Biogas Fermentantion | METNGKKNGICDPYEKSIREFIEEFERIEKKLKQTGG* |
| JGI24714J26587_100844351 | 3300002167 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNSICDPYEKSIREFKEEFERIEK |
| JGI24712J26585_101050171 | 3300002168 | Biogas Fermentantion | DYEWKQMVKKNDICDPYEKSIREFKEEYERIEKKFIEEYKRIEKKLKQTGG* |
| JGI24711J26586_101160043 | 3300002170 | Biogas Fermentantion | KKVKIMPTYDDPDYEWKQMIKKNGICDPYEKSIREFKEEFERIEKKLKQTGG* |
| JGI24711J26586_101387491 | 3300002170 | Biogas Fermentantion | MPTYDDPDYEWKQMIKKNGICDPYEKSIREFKEEYERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24711J26586_101417312 | 3300002170 | Biogas Fermentantion | MPTYDDPDYEWKQMVKRNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| JGI24709J26583_100855661 | 3300002173 | Biogas Fermentantion | KKVKIMPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEYERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24709J26583_100954821 | 3300002173 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNSICDPYEKSIREFKEEFERIEKKLKQTGG* |
| JGI24709J26583_101266942 | 3300002173 | Biogas Fermentantion | MPTYDXXDYEWKQMVKXNGICDPYEESIREFKEEXERIEKKLKQTGG* |
| JGI24709J26583_102052071 | 3300002173 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEIERI |
| JGI24710J26742_101080641 | 3300002174 | Biogas Fermentantion | MPTYDDPDYEWKQMVKRNGICDPYEESIREFKEEYERIEKKLKQTGG* |
| JGI24710J26742_101297102 | 3300002174 | Biogas Fermentantion | MMPTYDDPDYEWKQMVKKNGICDPYEKSIRKFKEEIERIEKKLKQTGG* |
| JGI24710J26742_101895192 | 3300002174 | Biogas Fermentantion | MPMYDDPDYEWKQMIKKNGICDPYEKSIXEFKEEFERIEKEFKEEYKRIEKKLKQTGG* |
| JGI24710J26742_102028152 | 3300002174 | Biogas Fermentantion | MMMPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| JGI24710J26742_102175332 | 3300002174 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEESIRGFKEEFERIEKKLKQTGG* |
| JGI24504J29685_10255401 | 3300002293 | Biogas Fermentantion | MPVYDDPDYEWKQMIKKNGICDPYEKSIREFKEEYERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24500J29687_100269111 | 3300002377 | Biogas Fermentantion | MPTYDDPDYEWKQMIKKNDICDPYEKSIREFKEEYERIEKKLKQTGG* |
| JGI24500J29687_100374561 | 3300002377 | Biogas Fermentantion | VKIMPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| JGI24502J29692_101151831 | 3300002378 | Biogas Fermentantion | DPDYEWKQMIKKNDICDPYEKSIREFKEEFERIEKKLKQTGG* |
| JGI24503J29689_100346951 | 3300002392 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNDICDPYEKSIREFKEEFERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24503J29689_100565321 | 3300002392 | Biogas Fermentantion | DPDYEWKQMIKKNGICDPYEKSIREFKEEYERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24503J29689_100625672 | 3300002392 | Biogas Fermentantion | MPVYDDPDYEWKQMVKKNDICDPYEKSIREFKEEYERIEKEFIEEYKRIEKKLKQTGG* |
| JGI24503J29689_101114091 | 3300002392 | Biogas Fermentantion | DDPDYEWKQMIKKNGICDPYEKSIREFKEEYERIEKKLKQTGG* |
| draft_103386131 | 3300002898 | Biogas Fermenter | DPDYAWKQMVKKNGICDPYEESIREFIEEYKRIEKKLKQTGG* |
| LSCM3L_10563521 | 3300003667 | Coalbed Water | KKNGICDPYEKSIREFKEEFERIEKEFIEEYKRIEKKLKQTGG* |
| Ga0078910_1087035 | 3300005835 | Biogas Reactor | MPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| Ga0078910_1265233 | 3300005835 | Biogas Reactor | MPTYDDPDYEWKQMIKKNGICDPYEKSIREFKEEFERIEKEFIEEYKRIEKKLKQTGG* |
| Ga0079223_104011393 | 3300006801 | Agricultural Soil | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGE* |
| Ga0075464_103911553 | 3300006805 | Aqueous | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGR* |
| Ga0079224_1012476163 | 3300009095 | Agricultural Soil | MPVYEDPDYEWKQMVKKNGICDPYEESIREFKEEYERIEKEFIEEYKRIEKKLKQTGG* |
| Ga0123326_11878461 | 3300009647 | Anaerobic Biogas Reactor | IPVYDDPDYEWKQMVKKNGICDPYEKSIREFIEEFERIEKKLKQTGG* |
| Ga0116179_11599102 | 3300009657 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKN* |
| Ga0116188_10745004 | 3300009658 | Anaerobic Digestor Sludge | MMPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEIERIEKEFIEEYKRIEKKLKQTGG* |
| Ga0116182_10750911 | 3300009666 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTG |
| Ga0116147_10108008 | 3300009667 | Anaerobic Digestor Sludge | MMMPTYDDPDYEWKQMVKKNGVCDPYEKSIREFKEEIERIEKEFIEEYKRIEKKLKQTGG |
| Ga0116180_11840572 | 3300009668 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTDG* |
| Ga0116183_10893967 | 3300009670 | Anaerobic Digestor Sludge | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG* |
| Ga0123334_10834084 | 3300009671 | Anaerobic Biogas Reactor | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFIEEFERIEKKLKQTGG* |
| Ga0116173_11266975 | 3300009674 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFIEEYKRIEKKLKQTGG* |
| Ga0123335_12170931 | 3300009680 | Anaerobic Biogas Reactor | IMPTYDDPDYEWKQMVKKNGICDPYEESIREFEEEFERIEKKLKQTGG* |
| Ga0123335_14873502 | 3300009680 | Anaerobic Biogas Reactor | VEIMPTYDDPDYEWKQMLKKNGICDPYEESIREFKEEYKRIEKKLKQTGG* |
| Ga0116142_103866481 | 3300009685 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQIGG* |
| Ga0116144_104224471 | 3300009687 | Anaerobic Digestor Sludge | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQ |
| Ga0116144_106572301 | 3300009687 | Anaerobic Digestor Sludge | MPIYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKK |
| Ga0116143_101426664 | 3300009690 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG* |
| Ga0116156_101352494 | 3300009780 | Anaerobic Digestor Sludge | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTNENYDKTS |
| Ga0134092_100019372 | 3300010286 | Switchgrass Degrading | MPVYDNPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| Ga0116250_100608734 | 3300010340 | Anaerobic Digestor Sludge | MMMPTYDDPDYEWKQMVKKNDVCDPYERSIREFKEEIERIEKKLKQTGG* |
| Ga0116237_115881312 | 3300010356 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQ |
| Ga0116251_102546893 | 3300010365 | Anaerobic Digestor Sludge | VKVKIMPVYDDPDYEWKQMVKKNDICDPYEKSIREFKEEFERIEKKLKQTGG* |
| Ga0172378_103628653 | 3300014203 | Groundwater | MPTYDDPDYEWKQMVKKNGICDPYKKSIREFKEEFERIEKKLKQTGG* |
| Ga0172378_110487062 | 3300014203 | Groundwater | MMMPSYDDPDYEWKQMVKKNDICDPYEKSIREFIEEYERIEKKLKQTGG* |
| Ga0172381_100463283 | 3300014204 | Landfill Leachate | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFEEAFKKIEDKMRKTNYGERSDN* |
| Ga0172381_106923671 | 3300014204 | Landfill Leachate | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEYERIEKKLKQTGG* |
| Ga0172377_103404755 | 3300014206 | Landfill Leachate | MPVYDDPDYEWKQMIKKNGICDPYEKSIREFKEEFERIEKKLKQTGR* |
| Ga0172377_110162762 | 3300014206 | Landfill Leachate | MPTYDDPDYEWKQMVKKNGICDPYEESIRGFKEEFERIEKKLKQTGR* |
| Ga0172377_114787131 | 3300014206 | Landfill Leachate | PDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG* |
| Ga0208693_10110978 | 3300025618 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTDG |
| Ga0208824_11144803 | 3300025629 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGVCDPYEKSIREFKEEIERIE |
| Ga0208198_11022524 | 3300025638 | Anaerobic Digestor Sludge | MMPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEIERIEKEFIEEYKRIEKKLKQTGG |
| Ga0209407_10431512 | 3300025689 | Anaerobic Digestor Sludge | MMPTYDDPDYEWKQMVKKNGVCDPYEKSIREFKEEIERIEKEFIEEYKRIEKKLKQTGG |
| Ga0209201_11082233 | 3300025708 | Anaerobic Digestor Sludge | MPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG |
| Ga0208916_104669961 | 3300025896 | Aqueous | MPVYDDPDYEWKQMIKKNGICDPYEKSIREFKEEFERIEKKLKQTGG |
| Ga0209510_10546324 | 3300026290 | Anaerobic Biogas Reactor | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFIEEFERIEKKLKQTGG |
| Ga0209537_100406215 | 3300027510 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFEHIEKKLKQTGG |
| Ga0209537_10485094 | 3300027510 | Biogas Fermentantion | MPVYDDPDYEWKQMIKKNGICDPYEKSIREFKEEYERIEKEFIEEYKRIEKKLKQTGG |
| Ga0209537_10907031 | 3300027510 | Biogas Fermentantion | MMPTYDDPDYEWKQMVKKNSICDPYEKSIREFKEEFERIEKKLKQTGG |
| Ga0209537_10946363 | 3300027510 | Biogas Fermentantion | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEYERIEKE |
| Ga0265295_104336510 | 3300028601 | Landfill Leachate | MVLEVKVKIMPTYDDPDYEWKQMIKKNGKCDPYEESIREFKEEYERIEKEFIEEYKRIEKKLKQTGR |
| Ga0265294_101225512 | 3300028602 | Groundwater | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKEFIEEYKRIEKKLKQTGG |
| Ga0265294_103711382 | 3300028602 | Groundwater | VKIMPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKFIEEYKRIEKKLKQTG |
| Ga0265294_103722422 | 3300028602 | Groundwater | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFIEEFERIEKKLKQTGG |
| Ga0265294_103850683 | 3300028602 | Groundwater | MMPSYDDPDYEWKQMVKKNGICDPYEKSIREFEEAFKKIEDKMRKTNYGERSDN |
| Ga0265294_104116511 | 3300028602 | Groundwater | MVLEVKVKIMPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGR |
| Ga0265294_104192831 | 3300028602 | Groundwater | MPVYDDPDYEWKQMVKKNGICDPYEKNIKEFKEEFERIEKKLKQTGG |
| Ga0265294_104528242 | 3300028602 | Groundwater | MPVYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG |
| Ga0265294_105029342 | 3300028602 | Groundwater | MPTYDDPDYEWKQMIKKNGICDPYEESIREFKEEYERIEKEFIEEYKRIEKKLKQTGG |
| Ga0265294_105561581 | 3300028602 | Groundwater | PDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGR |
| Ga0265294_105742521 | 3300028602 | Groundwater | MPVYDDPDYEWKQMVKKNDICDPYEKSIREFKEEFERIEKKFIEKKLKQTGR |
| Ga0265293_101032993 | 3300028603 | Landfill Leachate | MPTYDDPDYEWKQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG |
| Ga0265293_102500703 | 3300028603 | Landfill Leachate | KKNGICDPYEESIREFKEEYERIEKEFIEEYKRIEKKLKQTGG |
| Ga0265293_102553513 | 3300028603 | Landfill Leachate | MPTYDDPDYEWKQMVKKNDICDPYEKSIREFKEEYERIEKKLKQTGR |
| Ga0265293_106967761 | 3300028603 | Landfill Leachate | MPTYDDPDYEWKQMIKKNGICDPYEESIREFKEEYERIEKEFIEEYKRIEKKLKQTG |
| Ga0134854_10465234 | 3300029822 | Fermentation Pit Mud | MPVYDDPDYAWKQMVKKNGICDPYEKSIKEFKEEFERIEKKLKQTGE |
| Ga0134854_10465742 | 3300029822 | Fermentation Pit Mud | VDECYECDESCYWRVNQKVLILPVYDDPDYAWKQMVKKNGICDPYEKSIREFIEEFERIEKKLKQTGG |
| Ga0134835_10071593 | 3300029825 | Fermentation Pit Mud | MPVYDDPDYEWKQMVKKNGICNPYEKSIREFKEEFERIEKKLKQTGG |
| ⦗Top⦘ |