


| Basic Information | |
|---|---|
| Family ID | F091644 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.63 % |
| % of genes near scaffold ends (potentially truncated) | 79.44 % |
| % of genes from short scaffolds (< 2000 bps) | 85.05 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.832 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.430 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.121 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (35.514 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 5.61 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.74 |
| PF13759 | 2OG-FeII_Oxy_5 | 3.74 |
| PF13884 | Peptidase_S74 | 2.80 |
| PF13589 | HATPase_c_3 | 0.93 |
| PF00149 | Metallophos | 0.93 |
| PF13385 | Laminin_G_3 | 0.93 |
| PF01367 | 5_3_exonuc | 0.93 |
| PF11651 | P22_CoatProtein | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.83 % |
| All Organisms | root | All Organisms | 26.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2022920000|QLn_FQAYR3Y02QKR01 | Not Available | 515 | Open in IMG/M |
| 3300001968|GOS2236_1075691 | Not Available | 1842 | Open in IMG/M |
| 3300002161|JGI24766J26685_10092195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300002200|metazooDRAFT_1278037 | Not Available | 880 | Open in IMG/M |
| 3300002408|B570J29032_109815313 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| 3300002835|B570J40625_100161830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2523 | Open in IMG/M |
| 3300005582|Ga0049080_10080385 | Not Available | 1115 | Open in IMG/M |
| 3300005582|Ga0049080_10101333 | Not Available | 979 | Open in IMG/M |
| 3300005583|Ga0049085_10141081 | Not Available | 816 | Open in IMG/M |
| 3300005805|Ga0079957_1254574 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006802|Ga0070749_10006292 | Not Available | 7786 | Open in IMG/M |
| 3300006802|Ga0070749_10053863 | Not Available | 2444 | Open in IMG/M |
| 3300006802|Ga0070749_10281883 | Not Available | 935 | Open in IMG/M |
| 3300006802|Ga0070749_10348553 | All Organisms → Viruses | 823 | Open in IMG/M |
| 3300006802|Ga0070749_10509754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 655 | Open in IMG/M |
| 3300006802|Ga0070749_10587870 | Not Available | 601 | Open in IMG/M |
| 3300006863|Ga0075459_1023222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300007177|Ga0102978_1184644 | All Organisms → Viruses → Predicted Viral | 2102 | Open in IMG/M |
| 3300007234|Ga0075460_10257441 | Not Available | 580 | Open in IMG/M |
| 3300007344|Ga0070745_1174540 | Not Available | 804 | Open in IMG/M |
| 3300007346|Ga0070753_1289027 | Not Available | 588 | Open in IMG/M |
| 3300007363|Ga0075458_10129291 | Not Available | 784 | Open in IMG/M |
| 3300007539|Ga0099849_1244473 | Not Available | 661 | Open in IMG/M |
| 3300007540|Ga0099847_1149907 | Not Available | 694 | Open in IMG/M |
| 3300007541|Ga0099848_1291162 | Not Available | 562 | Open in IMG/M |
| 3300007542|Ga0099846_1307429 | Not Available | 542 | Open in IMG/M |
| 3300007640|Ga0070751_1378637 | Not Available | 513 | Open in IMG/M |
| 3300008116|Ga0114350_1057960 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
| 3300008116|Ga0114350_1160843 | Not Available | 610 | Open in IMG/M |
| 3300008266|Ga0114363_1230208 | Not Available | 540 | Open in IMG/M |
| 3300008448|Ga0114876_1183572 | Not Available | 725 | Open in IMG/M |
| 3300009149|Ga0114918_10274400 | Not Available | 951 | Open in IMG/M |
| 3300010300|Ga0129351_1225479 | Not Available | 721 | Open in IMG/M |
| 3300010318|Ga0136656_1276839 | Not Available | 548 | Open in IMG/M |
| 3300010368|Ga0129324_10304056 | Not Available | 627 | Open in IMG/M |
| 3300010370|Ga0129336_10312037 | Not Available | 872 | Open in IMG/M |
| 3300010370|Ga0129336_10371493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300010370|Ga0129336_10589981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300010389|Ga0136549_10148506 | Not Available | 1055 | Open in IMG/M |
| 3300010885|Ga0133913_10005524 | Not Available | 32559 | Open in IMG/M |
| 3300012012|Ga0153799_1069933 | Not Available | 634 | Open in IMG/M |
| 3300012017|Ga0153801_1074527 | Not Available | 596 | Open in IMG/M |
| 3300012726|Ga0157597_1207745 | Not Available | 541 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10653786 | Not Available | 558 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10161973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1572 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10424619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10743104 | Not Available | 615 | Open in IMG/M |
| 3300017736|Ga0181365_1002430 | All Organisms → Viruses → Predicted Viral | 4483 | Open in IMG/M |
| 3300017747|Ga0181352_1170991 | Not Available | 567 | Open in IMG/M |
| 3300017754|Ga0181344_1082861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300017761|Ga0181356_1035060 | Not Available | 1782 | Open in IMG/M |
| 3300017766|Ga0181343_1097881 | Not Available | 834 | Open in IMG/M |
| 3300017774|Ga0181358_1080908 | Not Available | 1186 | Open in IMG/M |
| 3300017788|Ga0169931_10779281 | Not Available | 617 | Open in IMG/M |
| 3300017991|Ga0180434_10879628 | Not Available | 675 | Open in IMG/M |
| 3300018080|Ga0180433_10495279 | Not Available | 930 | Open in IMG/M |
| 3300018080|Ga0180433_10596401 | Not Available | 830 | Open in IMG/M |
| 3300018080|Ga0180433_10852571 | Not Available | 670 | Open in IMG/M |
| 3300018080|Ga0180433_10998780 | Not Available | 611 | Open in IMG/M |
| 3300019783|Ga0181361_105388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50 | 976 | Open in IMG/M |
| 3300020204|Ga0194116_10003715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18148 | Open in IMG/M |
| 3300020551|Ga0208360_1038825 | Not Available | 608 | Open in IMG/M |
| 3300021376|Ga0194130_10294113 | Not Available | 905 | Open in IMG/M |
| 3300023179|Ga0214923_10082980 | Not Available | 2244 | Open in IMG/M |
| 3300023179|Ga0214923_10577238 | Not Available | 536 | Open in IMG/M |
| 3300024262|Ga0210003_1358804 | Not Available | 540 | Open in IMG/M |
| 3300024433|Ga0209986_10346326 | Not Available | 690 | Open in IMG/M |
| 3300024510|Ga0255187_1031326 | Not Available | 734 | Open in IMG/M |
| 3300024550|Ga0255266_1131665 | Not Available | 573 | Open in IMG/M |
| 3300024860|Ga0256344_1093852 | Not Available | 648 | Open in IMG/M |
| 3300025635|Ga0208147_1000761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10867 | Open in IMG/M |
| 3300025889|Ga0208644_1009831 | Not Available | 6625 | Open in IMG/M |
| 3300025889|Ga0208644_1243726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300025889|Ga0208644_1366341 | Not Available | 543 | Open in IMG/M |
| 3300025896|Ga0208916_10173363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300026473|Ga0255166_1007853 | Not Available | 2439 | Open in IMG/M |
| 3300027688|Ga0209553_1268578 | Not Available | 527 | Open in IMG/M |
| 3300027888|Ga0209635_11147343 | Not Available | 522 | Open in IMG/M |
| 3300027917|Ga0209536_101364067 | Not Available | 866 | Open in IMG/M |
| 3300028025|Ga0247723_1136932 | Not Available | 584 | Open in IMG/M |
| 3300031565|Ga0307379_11192972 | Not Available | 632 | Open in IMG/M |
| 3300031565|Ga0307379_11418195 | Not Available | 559 | Open in IMG/M |
| 3300031673|Ga0307377_10812759 | Not Available | 646 | Open in IMG/M |
| 3300031673|Ga0307377_10898574 | Not Available | 604 | Open in IMG/M |
| 3300031758|Ga0315907_10460693 | Not Available | 1013 | Open in IMG/M |
| 3300031857|Ga0315909_10344071 | Not Available | 1093 | Open in IMG/M |
| 3300031951|Ga0315904_10295233 | Not Available | 1522 | Open in IMG/M |
| 3300032046|Ga0315289_11463811 | Not Available | 524 | Open in IMG/M |
| 3300032053|Ga0315284_12315601 | Not Available | 530 | Open in IMG/M |
| 3300033980|Ga0334981_0489830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300033981|Ga0334982_0084816 | All Organisms → Viruses → Predicted Viral | 1691 | Open in IMG/M |
| 3300033993|Ga0334994_0060443 | Not Available | 2331 | Open in IMG/M |
| 3300033997|Ga0310131_095005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. CH-040 | 523 | Open in IMG/M |
| 3300034061|Ga0334987_0108257 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
| 3300034062|Ga0334995_0201911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
| 3300034063|Ga0335000_0209075 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300034063|Ga0335000_0376605 | Not Available | 851 | Open in IMG/M |
| 3300034063|Ga0335000_0564936 | Not Available | 645 | Open in IMG/M |
| 3300034073|Ga0310130_0013724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2730 | Open in IMG/M |
| 3300034106|Ga0335036_0846030 | Not Available | 525 | Open in IMG/M |
| 3300034109|Ga0335051_0237410 | Not Available | 900 | Open in IMG/M |
| 3300034112|Ga0335066_0077562 | Not Available | 2144 | Open in IMG/M |
| 3300034166|Ga0335016_0640155 | Not Available | 574 | Open in IMG/M |
| 3300034200|Ga0335065_0569613 | Not Available | 666 | Open in IMG/M |
| 3300034272|Ga0335049_0098333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2134 | Open in IMG/M |
| 3300034356|Ga0335048_0539889 | Not Available | 551 | Open in IMG/M |
| 3300034356|Ga0335048_0613994 | Not Available | 502 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.61% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 4.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.74% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.87% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.87% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.87% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.87% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.93% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.93% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2022920000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024860 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033997 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| QL_na_1184210 | 2022920000 | Saline Water | MVEEVQGDQTRISLSFNTFPIGSIGEEVDLTGLKI |
| GOS2236_10756914 | 3300001968 | Marine | PSHLTHMVETLKGDDVRVSMSFNTFPTGHIGDDDNLTGLEL* |
| JGI24766J26685_100921953 | 3300002161 | Freshwater And Sediment | THMVETVQGDERVSLAFNTFPVGYVGEEESLTALHLRN* |
| metazooDRAFT_12780373 | 3300002200 | Lake | VEAKQGENIRTSLAFNTFPVGQVGENLDMTGLDL* |
| B570J29032_1098153135 | 3300002408 | Freshwater | HMVPNVQGETTRISLSFNTFPVGTVGEEMDLTGLKLEA* |
| B570J40625_1001618301 | 3300002835 | Freshwater | THMVQTVQGEDTRISLSFNTFPVGYVGDEKSLTGLHLRD* |
| Ga0049080_100803851 | 3300005582 | Freshwater Lentic | VPTLQGEDQRVSMSFNTFPVGYVGSDDDLTGLRL* |
| Ga0049080_101013334 | 3300005582 | Freshwater Lentic | MLFPSSLTHMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE* |
| Ga0049085_101410811 | 3300005583 | Freshwater Lentic | LTHMVETIQGPETRISLSFNSFPTGYLGDEDDLTRLDIE* |
| Ga0079957_12545741 | 3300005805 | Lake | LMLFPSSLTHMVETVQGDERVSLAFNTFPVGYVGEEESLTALHI* |
| Ga0070749_100062921 | 3300006802 | Aqueous | MVETVQGDERVSLSYNTFPVGYVGEEESLTALHLEN* |
| Ga0070749_100538634 | 3300006802 | Aqueous | HMVETVQGNDTRISLSFNTFPVGNFGQDESLTGLHL* |
| Ga0070749_102818831 | 3300006802 | Aqueous | MVETVQGESTRISLSFNTFPVGNIGEEVDLTGLKLETAKG* |
| Ga0070749_103485532 | 3300006802 | Aqueous | MVEGVKGDHTRISLSFNTFPVGLVGEEVDLTALRLEDVER* |
| Ga0070749_105097541 | 3300006802 | Aqueous | SLTHMVEAVQQERVSLSFNTFPVGYVGEEESLTALHLENPQGAA* |
| Ga0070749_105878702 | 3300006802 | Aqueous | MFPVEGENTRISMSFNTFPVGSVGDEMELTGLKLEA* |
| Ga0075459_10232221 | 3300006863 | Aqueous | MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA* |
| Ga0102978_11846446 | 3300007177 | Freshwater Lake | VPEVKGDDVRISLSFNTFPVGVVGEEMDLTGLKLEA* |
| Ga0075460_102574411 | 3300007234 | Aqueous | PSSLTHMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE* |
| Ga0070745_11745402 | 3300007344 | Aqueous | MVPEVKGDDTRISLSFNTFPVGVVGEEMDLTGLRLEA* |
| Ga0070753_12890271 | 3300007346 | Aqueous | ETVQGDERISLSFNTFPVGLAGSEESLTALHLRD* |
| Ga0075458_101292911 | 3300007363 | Aqueous | MLFPSSLTHMVETVQGDERVSLAFNTFPVGYVGDEENLTALHLRN* |
| Ga0099849_12444731 | 3300007539 | Aqueous | VETVQGDQTRISLSFNTFPIGLVGDEMNLTGLQLESVKG* |
| Ga0099847_11499071 | 3300007540 | Aqueous | QGDQTRISLSFNTFPIGLVGDEMNLTGLQLESVKG* |
| Ga0099848_12911621 | 3300007541 | Aqueous | THMVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLEAAKG* |
| Ga0099846_13074291 | 3300007542 | Aqueous | MVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE* |
| Ga0070751_13786371 | 3300007640 | Aqueous | ETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE* |
| Ga0114350_10579601 | 3300008116 | Freshwater, Plankton | TVKGDDVRISMSFNTFPVGVVGDELSLTGLKLEA* |
| Ga0114350_11608431 | 3300008116 | Freshwater, Plankton | EVKGDDTRISLSFNTFPVGVVGEEMDLTGLKLEA* |
| Ga0114363_12302082 | 3300008266 | Freshwater, Plankton | VQQERVSLSFNTFPVGYVGEEESLTALHLENPQGAA* |
| Ga0114876_11835722 | 3300008448 | Freshwater Lake | MVPNVQGETTRISLSFNTFPVGTVGEEMDLTGLKLEA* |
| Ga0114918_102744004 | 3300009149 | Deep Subsurface | GDQTRISLSFNTFPIGLVGDEMNLTGLQLESVKG* |
| Ga0129351_12254793 | 3300010300 | Freshwater To Marine Saline Gradient | QGDQTRISLSFNTFPVGVVGEEMDLTGLKLEAVKG* |
| Ga0136656_12768391 | 3300010318 | Freshwater To Marine Saline Gradient | LTHMVETVKEEDRISLSFNTFPVGYVGEEESLTALHLEN* |
| Ga0129324_103040561 | 3300010368 | Freshwater To Marine Saline Gradient | TRISLSFNTFPIGLVGDEMNLTGLQIGELDGALR* |
| Ga0129336_103120371 | 3300010370 | Freshwater To Marine Saline Gradient | TVEGEDVRVSLSFNTFPAGTVGEEMDLTGLKLEV* |
| Ga0129336_103714933 | 3300010370 | Freshwater To Marine Saline Gradient | THMVPTVESEQTRISLSFNTFPVGNVGEEMDLTGLQLGELDGAFR* |
| Ga0129336_105899811 | 3300010370 | Freshwater To Marine Saline Gradient | NVPPVEGENTRISMSFNTFPVGSVGDEMELTGLKLEA* |
| Ga0136549_101485064 | 3300010389 | Marine Methane Seep Sediment | GEATRISLSFNTFPVGVVGEEMDLTGLKLETVKG* |
| Ga0133913_1000552435 | 3300010885 | Freshwater Lake | SSFTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL* |
| Ga0153799_10699333 | 3300012012 | Freshwater | HMVPTVEGEDVRVSLSFNTFPAGTVGEEMDLTGLKLEV* |
| Ga0153801_10745271 | 3300012017 | Freshwater | LTHMVPTVESEQTRISLSFNTFPVGNVGEEVDLTGLQLGELDGAFR* |
| Ga0157597_12077452 | 3300012726 | Freshwater | LEHNVPTVQGDDVRISMSFNTFPVGVVGDELSLTGLKLEA* |
| (restricted) Ga0172367_106537862 | 3300013126 | Freshwater | LEHMVETVNAENTRISLSFNTFPVGIVGEEKDLTLLELT* |
| (restricted) Ga0172373_101619731 | 3300013131 | Freshwater | THMVESVQQERVSLSFNTFPVGYVGEEESLTALHLEN* |
| (restricted) Ga0172372_104246193 | 3300013132 | Freshwater | MVPTVEGEDVRVSLSFNTFPAGTVGEEMDLTGLKLEV* |
| (restricted) Ga0172372_107431041 | 3300013132 | Freshwater | THMVQTVESEKTRISLAFNTFPVGHVGDEMNLTGLSLGELDGAFL* |
| Ga0181365_10024301 | 3300017736 | Freshwater Lake | HMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL |
| Ga0181352_11709911 | 3300017747 | Freshwater Lake | THMVETVQGDERVSLAFNTFPVGYVGEEESLTALHLRN |
| Ga0181344_10828611 | 3300017754 | Freshwater Lake | THMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE |
| Ga0181356_10350605 | 3300017761 | Freshwater Lake | PSSFTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL |
| Ga0181343_10978811 | 3300017766 | Freshwater Lake | MVETVKGEDTRISLSFNTFPVGNIGEEVDLTGLKLESIKE |
| Ga0181358_10809084 | 3300017774 | Freshwater Lake | FTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL |
| Ga0169931_107792811 | 3300017788 | Freshwater | PSHLTHMVESVQQERVSLSFNTFPVGYVGEEESLTALHLEN |
| Ga0180434_108796281 | 3300017991 | Hypersaline Lake Sediment | THMVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE |
| Ga0180433_104952791 | 3300018080 | Hypersaline Lake Sediment | HMVETVKGDQQRISLSFNTFPVGSVGDEMNLTGLQIGELDGALR |
| Ga0180433_105964013 | 3300018080 | Hypersaline Lake Sediment | THMVETVQGNNTRISLSFNTFPVGNFGDDLSLTGLHL |
| Ga0180433_108525711 | 3300018080 | Hypersaline Lake Sediment | MVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE |
| Ga0180433_109987801 | 3300018080 | Hypersaline Lake Sediment | VQGDQTRISLSFNTFPVGVVGEEMDLTGLKLEAVKG |
| Ga0181361_1053884 | 3300019783 | Freshwater Lake | FPSSFTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL |
| Ga0194116_100037151 | 3300020204 | Freshwater Lake | QTLDHDQTRISLAFNTFPIGHIGEEVDLTGLNLGELDGAFR |
| Ga0208360_10388251 | 3300020551 | Freshwater | SSLEHNVPTVQGEDVRISMSFNTFPVGIVGDEMQLTGLKLEA |
| Ga0194130_102941133 | 3300021376 | Freshwater Lake | VQGDQTRISLSFNTFPVGSVGDEMNLTGLQLESVKG |
| Ga0214923_100829803 | 3300023179 | Freshwater | MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLRLEA |
| Ga0214923_105772382 | 3300023179 | Freshwater | PEVKGEDTRISLSFNTFPVGVVGEEMDLTGLRLEA |
| Ga0210003_13588042 | 3300024262 | Deep Subsurface | ETVKGEDTRISLSFNTFPVGLVGEEMDLTGLKLESIKE |
| Ga0209986_103463261 | 3300024433 | Deep Subsurface | VQGEATRISLSFNTFPVGVVGEEMDLTGLKLEAVKG |
| Ga0255187_10313262 | 3300024510 | Freshwater | MLFPSSLTHMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE |
| Ga0255266_11316651 | 3300024550 | Freshwater | VPEIKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEI |
| Ga0256344_10938522 | 3300024860 | Freshwater | MVPTIEGDDTRISLSFNTFPVGVVGEEMDLTGLKLEA |
| Ga0208147_10007619 | 3300025635 | Aqueous | MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA |
| Ga0208644_10098314 | 3300025889 | Aqueous | MVETVKEEDRISLSFNTFPVGYVGEEESLTALHLEQ |
| Ga0208644_12437261 | 3300025889 | Aqueous | VPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA |
| Ga0208644_13663412 | 3300025889 | Aqueous | VQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE |
| Ga0208916_101733633 | 3300025896 | Aqueous | PTVQGEQTRISLSFNTFPVGTVGEEMDLTGLKLEA |
| Ga0255166_10078532 | 3300026473 | Freshwater | MVQTVESDQTRISLAFNTFPVGNIGEELDLTGLQLGELDGAFR |
| Ga0209553_12685782 | 3300027688 | Freshwater Lake | SLTHMVPTLQGEDQRVSMSFNTFPVGYVGSDDDLTGLRL |
| Ga0209635_111473431 | 3300027888 | Marine Sediment | LTHMVETVQGDQQRISLSFNTFPVGLVGDEMNLTGLQIGELDGALR |
| Ga0209536_1013640671 | 3300027917 | Marine Sediment | QGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE |
| Ga0247723_11369321 | 3300028025 | Deep Subsurface Sediment | SLEHNVPTVQGNDVRISMSFNTFPVGIVGDEMSLTGLKLEV |
| Ga0307379_111929721 | 3300031565 | Soil | HMVETVKGEDTRVSLSFNTFPVGLVGEEMDLTGLKLESIKE |
| Ga0307379_114181951 | 3300031565 | Soil | MVETVQGDQTRISLSFNTFPIGLVGDEMNLTGLQIGELDGALR |
| Ga0307377_108127593 | 3300031673 | Soil | HMVETVKGEDTRISLSFNTFPVGLVGEEMDLTGLKLESIKE |
| Ga0307377_108985743 | 3300031673 | Soil | VQGEATRISLSFNTFPVGVVGEEMDLTGLKLETVKG |
| Ga0315907_104606934 | 3300031758 | Freshwater | VETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE |
| Ga0315909_103440711 | 3300031857 | Freshwater | SLTHMVETVQGEDRVSLAFNTFPVGYVGEEESLTALHLKE |
| Ga0315904_102952335 | 3300031951 | Freshwater | MVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE |
| Ga0315289_114638112 | 3300032046 | Sediment | THMVPTLQGDDQRVSMSFNTFPVGYVGSDDDLTGLRL |
| Ga0315284_123156012 | 3300032053 | Sediment | LTHMVPTLQGDDQRVSMSFNTFPVGYVGSDDDLTGLRL |
| Ga0334981_0489830_8_121 | 3300033980 | Freshwater | MVPEVKGDDVRISLSFNTFPVGVVGEEMDLTGLKLEA |
| Ga0334982_0084816_1572_1691 | 3300033981 | Freshwater | THMVQTVQGEDTRISLSFNTFPVGYVGDEKSLTGLHLRD |
| Ga0334994_0060443_1_111 | 3300033993 | Freshwater | VQTVQGEDTRISLSFNTFPVGYVGDEKSLTGLHLRD |
| Ga0310131_095005_308_430 | 3300033997 | Fracking Water | MVQTLDHHETRISLAFNTFPVGVVGEEMDLTSLKLETAQG |
| Ga0334987_0108257_940_1071 | 3300034061 | Freshwater | MVPTVESEQTRISLSFNTFPVGNVGEEMDLTGLQLGELDGAFR |
| Ga0334995_0201911_1257_1379 | 3300034062 | Freshwater | REHNVPTVQGEDVRISMSFNTFPVGIVGDEMQLTGLKLEA |
| Ga0335000_0209075_107_229 | 3300034063 | Freshwater | MVETVKGEDTRISLSFNTFPVGLVGEEMDLTGLKLESIKE |
| Ga0335000_0376605_734_850 | 3300034063 | Freshwater | THMVETVQGDDRVSLAFNTFPVGYVGEEEQLTALHLEN |
| Ga0335000_0564936_53_184 | 3300034063 | Freshwater | MVPTVESEQTRISLSFNTFPVGNIGEEVDLTGLQLGELDGAFR |
| Ga0310130_0013724_2484_2597 | 3300034073 | Fracking Water | MVPEIKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEI |
| Ga0335036_0846030_67_180 | 3300034106 | Freshwater | MVPTIQGEKTRISMSFNTFPVGTVGEEMELTGLKLEA |
| Ga0335051_0237410_784_900 | 3300034109 | Freshwater | HNVPTAQGDDVRISMSFNTFPVGVVGDELSLTGLKLEA |
| Ga0335066_0077562_74_196 | 3300034112 | Freshwater | MVETVKGEDTRISLSFNTFPVGNIGEEVDLTGLKLESAQG |
| Ga0335016_0640155_453_572 | 3300034166 | Freshwater | EHNVPTVQGEDVRISMSFNTFPVGIVGDEMSLTGLKLEA |
| Ga0335065_0569613_1_117 | 3300034200 | Freshwater | HMVPTIQGEQTRISLSFNTFPVGTVGEEMDLTGLKLEA |
| Ga0335049_0098333_1_117 | 3300034272 | Freshwater | HNVPTVTGDDVRISMSFNTFPVGVVGDEMQLTGLKLEA |
| Ga0335048_0539889_163_294 | 3300034356 | Freshwater | MVQTVESDQTRISLSFNTFPVGNVGEEMDLTGLQLGELDGAFR |
| Ga0335048_0613994_344_454 | 3300034356 | Freshwater | MVEQVKGEDTRISLSFNTFPKGIIGDEIALTTLKLG |
| ⦗Top⦘ |