


| Basic Information | |
|---|---|
| Family ID | F091575 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAQIETISKAEAVKQQSRQLRGHIARDLADTATPFDKEGYS |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 93.46 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 97.20 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.336 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.776 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.710 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.664 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01053 | Cys_Met_Meta_PP | 45.79 |
| PF02441 | Flavoprotein | 4.67 |
| PF13404 | HTH_AsnC-type | 3.74 |
| PF02547 | Queuosine_synth | 3.74 |
| PF01037 | AsnC_trans_reg | 1.87 |
| PF04403 | PqiA | 0.93 |
| PF08734 | GYD | 0.93 |
| PF03886 | ABC_trans_aux | 0.93 |
| PF00583 | Acetyltransf_1 | 0.93 |
| PF00078 | RVT_1 | 0.93 |
| PF01113 | DapB_N | 0.93 |
| PF13412 | HTH_24 | 0.93 |
| PF00732 | GMC_oxred_N | 0.93 |
| PF06983 | 3-dmu-9_3-mt | 0.93 |
| PF00561 | Abhydrolase_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 45.79 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 45.79 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 45.79 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 45.79 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 45.79 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 45.79 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 45.79 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 45.79 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 45.79 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 45.79 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 45.79 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 3.74 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.93 |
| COG2995 | Intermembrane transporter PqiABC subunit PqiA | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.93 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.34 % |
| All Organisms | root | All Organisms | 47.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_101333000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 603 | Open in IMG/M |
| 3300004082|Ga0062384_100480856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 819 | Open in IMG/M |
| 3300004091|Ga0062387_101433038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300004643|Ga0062591_101170140 | Not Available | 746 | Open in IMG/M |
| 3300005169|Ga0066810_10104714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 631 | Open in IMG/M |
| 3300005332|Ga0066388_101102967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1344 | Open in IMG/M |
| 3300005355|Ga0070671_100153079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1948 | Open in IMG/M |
| 3300005435|Ga0070714_100582374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1073 | Open in IMG/M |
| 3300005454|Ga0066687_10055314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1866 | Open in IMG/M |
| 3300005553|Ga0066695_10874760 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_102899983 | Not Available | 930 | Open in IMG/M |
| 3300006806|Ga0079220_11793705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300006893|Ga0073928_10836488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 634 | Open in IMG/M |
| 3300007265|Ga0099794_10540711 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009012|Ga0066710_104088927 | Not Available | 545 | Open in IMG/M |
| 3300009156|Ga0111538_12369876 | Not Available | 666 | Open in IMG/M |
| 3300010043|Ga0126380_10999602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300010048|Ga0126373_12413874 | Not Available | 585 | Open in IMG/M |
| 3300010341|Ga0074045_10766519 | Not Available | 611 | Open in IMG/M |
| 3300010360|Ga0126372_11686077 | Not Available | 675 | Open in IMG/M |
| 3300010361|Ga0126378_13010172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300010366|Ga0126379_12978022 | Not Available | 567 | Open in IMG/M |
| 3300010376|Ga0126381_101186546 | Not Available | 1103 | Open in IMG/M |
| 3300010398|Ga0126383_12746503 | Not Available | 575 | Open in IMG/M |
| 3300011271|Ga0137393_10324588 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300011999|Ga0120148_1111520 | Not Available | 524 | Open in IMG/M |
| 3300012096|Ga0137389_10894504 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012209|Ga0137379_11066908 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012469|Ga0150984_113585365 | Not Available | 699 | Open in IMG/M |
| 3300012922|Ga0137394_11478441 | Not Available | 539 | Open in IMG/M |
| 3300012930|Ga0137407_12417179 | Not Available | 502 | Open in IMG/M |
| 3300012948|Ga0126375_11620043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300015357|Ga0134072_10068456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300016319|Ga0182033_11104392 | Not Available | 708 | Open in IMG/M |
| 3300016387|Ga0182040_10396091 | Not Available | 1082 | Open in IMG/M |
| 3300016387|Ga0182040_11877680 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300016422|Ga0182039_11512144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300016445|Ga0182038_10319336 | Not Available | 1276 | Open in IMG/M |
| 3300017792|Ga0163161_11552782 | Not Available | 582 | Open in IMG/M |
| 3300017933|Ga0187801_10159908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300017943|Ga0187819_10836115 | Not Available | 516 | Open in IMG/M |
| 3300017970|Ga0187783_10324490 | Not Available | 1122 | Open in IMG/M |
| 3300017973|Ga0187780_10441933 | Not Available | 925 | Open in IMG/M |
| 3300017995|Ga0187816_10028308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2255 | Open in IMG/M |
| 3300018062|Ga0187784_11368700 | Not Available | 561 | Open in IMG/M |
| 3300018469|Ga0190270_11502218 | Not Available | 723 | Open in IMG/M |
| 3300020579|Ga0210407_10806180 | Not Available | 724 | Open in IMG/M |
| 3300020579|Ga0210407_11135166 | Not Available | 591 | Open in IMG/M |
| 3300021086|Ga0179596_10108982 | Not Available | 1270 | Open in IMG/M |
| 3300021170|Ga0210400_10621220 | Not Available | 891 | Open in IMG/M |
| 3300021358|Ga0213873_10148300 | Not Available | 705 | Open in IMG/M |
| 3300021372|Ga0213877_10312616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300021404|Ga0210389_11168491 | Not Available | 593 | Open in IMG/M |
| 3300021432|Ga0210384_10982972 | Not Available | 746 | Open in IMG/M |
| 3300021445|Ga0182009_10056026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1684 | Open in IMG/M |
| 3300021479|Ga0210410_11582521 | Not Available | 548 | Open in IMG/M |
| 3300022533|Ga0242662_10073998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300022557|Ga0212123_10750145 | Not Available | 594 | Open in IMG/M |
| 3300024288|Ga0179589_10483791 | Not Available | 573 | Open in IMG/M |
| 3300025320|Ga0209171_10500771 | Not Available | 602 | Open in IMG/M |
| 3300025926|Ga0207659_11486090 | Not Available | 580 | Open in IMG/M |
| 3300025931|Ga0207644_11696668 | Not Available | 529 | Open in IMG/M |
| 3300026330|Ga0209473_1075402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1430 | Open in IMG/M |
| 3300026330|Ga0209473_1176696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300026552|Ga0209577_10072380 | Not Available | 2855 | Open in IMG/M |
| 3300027703|Ga0207862_1168802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300027768|Ga0209772_10116304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300027795|Ga0209139_10059150 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1345 | Open in IMG/M |
| 3300027869|Ga0209579_10739252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300028673|Ga0257175_1131165 | Not Available | 503 | Open in IMG/M |
| 3300030659|Ga0316363_10117065 | Not Available | 1169 | Open in IMG/M |
| 3300031545|Ga0318541_10626977 | Not Available | 601 | Open in IMG/M |
| 3300031546|Ga0318538_10659983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300031573|Ga0310915_10133023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1708 | Open in IMG/M |
| 3300031640|Ga0318555_10248385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300031668|Ga0318542_10275350 | Not Available | 859 | Open in IMG/M |
| 3300031681|Ga0318572_10234079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1078 | Open in IMG/M |
| 3300031708|Ga0310686_111137492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum | 626 | Open in IMG/M |
| 3300031723|Ga0318493_10774532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031751|Ga0318494_10654183 | Not Available | 615 | Open in IMG/M |
| 3300031751|Ga0318494_10840394 | Not Available | 538 | Open in IMG/M |
| 3300031754|Ga0307475_11058483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300031764|Ga0318535_10098431 | Not Available | 1279 | Open in IMG/M |
| 3300031770|Ga0318521_10164873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1265 | Open in IMG/M |
| 3300031770|Ga0318521_10781597 | Not Available | 581 | Open in IMG/M |
| 3300031780|Ga0318508_1243827 | Not Available | 516 | Open in IMG/M |
| 3300031798|Ga0318523_10467414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031819|Ga0318568_10401668 | Not Available | 854 | Open in IMG/M |
| 3300031832|Ga0318499_10425231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300031879|Ga0306919_11252332 | Not Available | 563 | Open in IMG/M |
| 3300031896|Ga0318551_10788274 | Not Available | 552 | Open in IMG/M |
| 3300031912|Ga0306921_10191059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2400 | Open in IMG/M |
| 3300031941|Ga0310912_10384609 | Not Available | 1092 | Open in IMG/M |
| 3300031941|Ga0310912_11402729 | Not Available | 527 | Open in IMG/M |
| 3300031945|Ga0310913_10323687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300031946|Ga0310910_11301446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031954|Ga0306926_12672517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300031959|Ga0318530_10241993 | Not Available | 743 | Open in IMG/M |
| 3300032042|Ga0318545_10137299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300032044|Ga0318558_10237211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300032059|Ga0318533_10546384 | Not Available | 849 | Open in IMG/M |
| 3300032076|Ga0306924_10828776 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1029 | Open in IMG/M |
| 3300032091|Ga0318577_10516039 | Not Available | 569 | Open in IMG/M |
| 3300032892|Ga0335081_10924594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
| 3300032896|Ga0335075_11272343 | Not Available | 631 | Open in IMG/M |
| 3300033004|Ga0335084_12359405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300033810|Ga0314872_024469 | Not Available | 554 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063454_1013330001 | 3300004081 | Soil | MVQIDSVSKPEAVKQQSRQLRGHIARDLRDTGTPFDKEGYSLLKFH |
| Ga0062384_1004808561 | 3300004082 | Bog Forest Soil | MVQIDSVSKPEAVKQQSRQLRGHIARDLRDTATPFDKEGYSLLK |
| Ga0062387_1014330381 | 3300004091 | Bog Forest Soil | VVQVVEPISSEKISKAEAIKLQSRHLRGHLARDLADTATPFDGEGYSLLKFH |
| Ga0062591_1011701402 | 3300004643 | Soil | MPTPMDAEISAPMDVIDNISKAEAVKQQSRQLRGNLARDLADTEAPFDNTSYS |
| Ga0066810_101047141 | 3300005169 | Soil | VAQIDTISKAEAIKQQSRQLRGTLATDLADTATPFDKVGYS |
| Ga0066388_1011029671 | 3300005332 | Tropical Forest Soil | MVQIDTVSKAEAVKQQSRQLRGHIARDLPDAEKPFDNEGYS |
| Ga0070671_1001530791 | 3300005355 | Switchgrass Rhizosphere | MEGSVARIDSISKAEAVKQQSRQLRGRLKEDLADTGKPFDK |
| Ga0070714_1005823741 | 3300005435 | Agricultural Soil | MAEIQTLSKAEAVKQQSRQLRGNLVRDLADTAHPFDNAGYSL |
| Ga0066687_100553141 | 3300005454 | Soil | MVQINSVSKAEAVKQQSRQLRGHIARDLADTTVPFDNQGYSLLKFH |
| Ga0066695_108747602 | 3300005553 | Soil | VARIETVSKAEAIKQQSRQLRGKLAEDLADTATPFD |
| Ga0066903_1028999832 | 3300005764 | Tropical Forest Soil | MAIIERLSKAEAIKQQSRQLRGNLARDLADATAPFDNDGYSL |
| Ga0079220_117937052 | 3300006806 | Agricultural Soil | MAALDTISKAEAIKQQSRQLRGNLARDLADTAHPFD |
| Ga0073928_108364881 | 3300006893 | Iron-Sulfur Acid Spring | MVQIDSVSKPEAIKQQSRQLRGHIARDLADTRTPFDKEGYSLLKFH |
| Ga0099794_105407111 | 3300007265 | Vadose Zone Soil | VARIETVSKAEAIKQQSRQLRGRLAEDLADTATPFDKSGYSLLKFH |
| Ga0066710_1040889272 | 3300009012 | Grasslands Soil | MAAIDTISKAEAVKQQSRQLRGNLATDLADTATPFD |
| Ga0111538_123698761 | 3300009156 | Populus Rhizosphere | MSAPTDVIDNISKAEAVKQQSRQLRGTLARDLADTGTLFDKTGYSLLK |
| Ga0126380_109996021 | 3300010043 | Tropical Forest Soil | MAQINTLSKAEAVKQQSRQLRGHIARDLADTGNPFDNEGYSLLKF |
| Ga0126373_124138742 | 3300010048 | Tropical Forest Soil | MVQVKSVSKAEAVKQQSRQLRGHIARDLVDTTAPF |
| Ga0074045_107665192 | 3300010341 | Bog Forest Soil | MVQVNSISKPEAVKQQSRQLRGHLARDLADTTAPFDKEGY |
| Ga0126372_116860772 | 3300010360 | Tropical Forest Soil | MVQIDTVSKAEAVKQQSRQLRGHIARDLPDAEKPFDNEGYSLLK |
| Ga0126378_130101721 | 3300010361 | Tropical Forest Soil | MGHRDAISKAEAVKQQSRRLRGNLVRDLGDTAAPFDNVGYSLLK |
| Ga0126379_129780221 | 3300010366 | Tropical Forest Soil | VARIESVSKAEAIKQQSRQLRGKIAEDLVDSAVPFD |
| Ga0126381_1011865461 | 3300010376 | Tropical Forest Soil | MAQINSVSKAEAVKQQSRQLRGNIARDLADTSTPFDKEGYSLLKFH |
| Ga0126383_127465032 | 3300010398 | Tropical Forest Soil | VAQVESISKAEAVKQQSRHLRGHIARDLADTAAAFDKEG |
| Ga0137393_103245881 | 3300011271 | Vadose Zone Soil | VARIETVSKAEAIKQQSRHLRGKLAEDLADTATPF |
| Ga0120148_11115201 | 3300011999 | Permafrost | LPGFASEGGGVAQIDTISKAEAIKQQSRQLRGTLAQDLADTATPFDKVVYS |
| Ga0137389_108945042 | 3300012096 | Vadose Zone Soil | VAQIETVSKAEAIKQKSRKLRGNLAQDLADTATPFDKA |
| Ga0137379_110669081 | 3300012209 | Vadose Zone Soil | VAQIETVSKAEAIKQQSRQLRGNLAEDLADTATPFDKSGYSLLKFH |
| Ga0150984_1135853651 | 3300012469 | Avena Fatua Rhizosphere | MARIETLSKAEILKQQSRQLRGNLARDLSDTATPFDNAG |
| Ga0137394_114784412 | 3300012922 | Vadose Zone Soil | MVQIDTISKPEAIKQQSRQLRGHIARDLADTTAPFDKEGY |
| Ga0137407_124171791 | 3300012930 | Vadose Zone Soil | VAQIDTVSKAEAIKQQSRQLRGKLAEDLADTATPF |
| Ga0126375_116200431 | 3300012948 | Tropical Forest Soil | MVQIKPVSKAETVKQQSRQLRGHLARDLSDTAKPFDNE |
| Ga0134072_100684563 | 3300015357 | Grasslands Soil | LGTTAVAALDTISKAEAIKQQSRHLRGNLARDLADTAHP |
| Ga0182033_111043922 | 3300016319 | Soil | MAQIDAISKPEAIKQQSRQLRGHIARDIADTATPFDKEGYALLKF |
| Ga0182040_103960912 | 3300016387 | Soil | VAQVESISKAEAVKHQSLQLRGHIARNLADMTVPFDKEE |
| Ga0182040_118776801 | 3300016387 | Soil | MSSIEHLSKPEAVKQQSRQLRGHIARDLADTTAPFDKEGYSLLK |
| Ga0182039_115121441 | 3300016422 | Soil | MAAIENVSKAEAIKQQSRQLRGNLARDLAETAAPFDN |
| Ga0182038_103193362 | 3300016445 | Soil | MVQVKSLSKAEAVKQQSRQLRGHIARDLGDTGTPFDNEGYSLLKF |
| Ga0163161_115527822 | 3300017792 | Switchgrass Rhizosphere | MSAPTDVIDNISKAEAVKQQSRQLRGTLARDLADT |
| Ga0187801_101599081 | 3300017933 | Freshwater Sediment | MAQIETTSKAEAVKQQSRQLRGHIARDLADTSTPF |
| Ga0187819_108361152 | 3300017943 | Freshwater Sediment | MEGSFVVQVVEKISKAEAIKQQSRQLRGRLVRDLADTATPFDG |
| Ga0187783_103244901 | 3300017970 | Tropical Peatland | VVQPVELAGEKLSKAEATKRKSRGLRGHLARDLADTATPFDGEGYS |
| Ga0187780_104419331 | 3300017973 | Tropical Peatland | VVQLVEKISKAEATKQQSHQLRGHLARDLADTATPFDGEGYSLLKFH |
| Ga0187816_100283081 | 3300017995 | Freshwater Sediment | MAIIDTLSKAEAIKQQSRQLRGNLARDLADIANPFDNAGYSLLKFH |
| Ga0187784_113687002 | 3300018062 | Tropical Peatland | VVHLVEKISKAEAVKQQSRQLRGHLARDLADVATPFDGEGYS |
| Ga0190270_115022182 | 3300018469 | Soil | VAQIDTISKAEAIKQQSRQLRGTLARDLVDAATPFDKAGYGLL |
| Ga0210407_108061802 | 3300020579 | Soil | MAQIDAISKPEAVKQQSRQLRGHIARDLGDTDTPF |
| Ga0210407_111351661 | 3300020579 | Soil | VVQAVEKISKAEAVKQQSRRLRGHLARDLVDAATPFDGEG |
| Ga0179596_101089823 | 3300021086 | Vadose Zone Soil | MAQIDAISKPEAVKQQSRQLRGHIARDLGDTTTPFDKEGYA |
| Ga0210400_106212201 | 3300021170 | Soil | MVQINSISKAEAVKQQSRQLRGHIARDLADTAVPFDNQGYSLL |
| Ga0213873_101483001 | 3300021358 | Rhizosphere | MTAFEKLSKSEATKEHSRQLRGRLAQDLADTTQPFDHE |
| Ga0213877_103126162 | 3300021372 | Bulk Soil | MADIERLSKAEAIKQQSRQLRGNLARDLVDTTAPFDNAGYSL |
| Ga0210389_111684911 | 3300021404 | Soil | MVQIDSVSKPEAIKQQSRQLRGHIARDLRDTGTPF |
| Ga0210384_109829722 | 3300021432 | Soil | VVEAVEKISKAEATKQQSRQLRGHLARDLADTAMPF |
| Ga0182009_100560264 | 3300021445 | Soil | MAEIQTLSKAEAVKQQSRQLRGNLVRDLADTAHPFDNAGYSLLKF |
| Ga0210410_115825212 | 3300021479 | Soil | MVQIDSVSKPEAIKQQSRQLRGHIARDLRDTGTPFDKEGYSLLKF |
| Ga0242662_100739983 | 3300022533 | Soil | MAAIENVSKPEAIKQQSRQLRGNLASDLADTATPFDNAGYSLLNTGVS |
| Ga0212123_107501452 | 3300022557 | Iron-Sulfur Acid Spring | MAEIDSISKAEAVKQQSRQLRGRLAADLADAAQPFDKEGYSLL |
| Ga0179589_104837912 | 3300024288 | Vadose Zone Soil | MVQIDTISKPEAVKQQSRQLRGHIARDLADTTTPFDKEGYAL |
| Ga0209171_105007712 | 3300025320 | Iron-Sulfur Acid Spring | MAEIDSISKAEAVKQQSRQLRGRLAQDLADMAQPFDKEGYSLLKF |
| Ga0207659_114860902 | 3300025926 | Miscanthus Rhizosphere | MDGTTPIQNVSKAEAVKQQSRGLRGNLVRDLADIATP |
| Ga0207644_116966682 | 3300025931 | Switchgrass Rhizosphere | VARIDSISKAEAVKQQSRQLRGRLKEDLADTGKPFDKE |
| Ga0209473_10754023 | 3300026330 | Soil | MASIDTVSKAEAVKQQSRQLRGNLARDLADTAHPFDNAGYSLLKF |
| Ga0209473_11766962 | 3300026330 | Soil | MAALDTISKAEAIKQQSRQLRGNLAHDLADTAHPFDKT |
| Ga0209577_100723804 | 3300026552 | Soil | MVQINTVSKAEAVKQQSRQLRGHIARDLADTTVPFDNQG |
| Ga0207862_11688022 | 3300027703 | Tropical Forest Soil | MVQIKSVSKAEAVKQQSRQLRGHLARDLSDTASPFDNE |
| Ga0209772_101163041 | 3300027768 | Bog Forest Soil | MAQIDTISKPEAIKQQSRQLRGHLTRDLAVPGTPFDKEGYALLK |
| Ga0209139_100591501 | 3300027795 | Bog Forest Soil | MAQIDSISKPEAIKQQSRQLRGHLARDLAATSAPFDK |
| Ga0209579_107392522 | 3300027869 | Surface Soil | VAQIETVSKAEAIKQQSRQLRGNLAADLADTTVPFDKTGYSLL |
| Ga0257175_11311652 | 3300028673 | Soil | MAQIDAISKPEAIKQQSRQLRGHIARDLGDTTTPFDKEG |
| Ga0316363_101170652 | 3300030659 | Peatlands Soil | VVQAVDKISKAEATKQQSRQLRGRLARDLADTATP |
| Ga0318541_106269772 | 3300031545 | Soil | MADIESLSKAEAIKQQSRQLRGNLARDLADSTAPFDNAGYSLLK |
| Ga0318538_106599832 | 3300031546 | Soil | MAAIENVSKAEAIKQQSRQLRGDLARDLAETAAPFDN |
| Ga0310915_101330231 | 3300031573 | Soil | MAAIENVSKAEAIKQQSRQLRGNLARDLGETAVPFDNSGYSL |
| Ga0318555_102483851 | 3300031640 | Soil | MPRPDAVSAAEAVKKWSRQLRGHLARDLADTAQPFDKEGYSLLK |
| Ga0318542_102753501 | 3300031668 | Soil | MAQIDAISKPEAIKQQSRQLRGHIARDIADTATPF |
| Ga0318572_102340793 | 3300031681 | Soil | MPRPDAVSAAEAVKKWSRQLRGHLARDLADTAQPFDKEGYS |
| Ga0310686_1111374921 | 3300031708 | Soil | MAQIDSISRPEAIEQQSRQLRGHIARDLPDTKVPFDKEG |
| Ga0318493_107745322 | 3300031723 | Soil | MAIIERLSKAEAIKQQSRQLRGNLARDLADATAPFDNDGYSLLKFH |
| Ga0318494_106541831 | 3300031751 | Soil | MAQIETISKAEAVKQQSRQLRGHIARDLADTTTPFDKEGYALLK |
| Ga0318494_108403942 | 3300031751 | Soil | MAVIERLSKAEAIKQQSRQLRGNLARDLADATAPFDNDA |
| Ga0307475_110584832 | 3300031754 | Hardwood Forest Soil | MVQIETVSKAEAVKQQSRHLRGNLARDLADTATPFDNTGYSLLK |
| Ga0318535_100984311 | 3300031764 | Soil | MVQVQSISKAEAVKQQSRQLRGRIARDLADTASPFDKEGY |
| Ga0318521_101648733 | 3300031770 | Soil | MAAIENVSKAEAIKQQSRQLRGNLARDVADTAAPFDNAGYS |
| Ga0318521_107815971 | 3300031770 | Soil | MVQVQSISKAEAVKQQSRQLRGHIARDLADTAAPFDKEGY |
| Ga0318508_12438271 | 3300031780 | Soil | MVQVQSISKAEAVKQQSRQLRGRIARDLADTASPFDKEGYALR |
| Ga0318523_104674141 | 3300031798 | Soil | MAQIETISKAEAVKQQSRQLRGHLTRDLADASAPFDKEGYALLK |
| Ga0318568_104016681 | 3300031819 | Soil | MAQIETISKAEAVKQQSRQLRGHIARDLADTTTPFDK |
| Ga0318499_104252312 | 3300031832 | Soil | MPRPDAVSAAEAVKKWSRQLRGHLARDLADTAQPFD |
| Ga0306919_112523321 | 3300031879 | Soil | MVQIKSVSKAEAVKQQSRQLRGHISRDLADTSTPFDNE |
| Ga0318551_107882741 | 3300031896 | Soil | MAQIETISKAEAVKQQSRQLRGHIARDLADTATPFDKEGYS |
| Ga0306921_101910594 | 3300031912 | Soil | VAQIESISKAEAVKQQSRQLRGHIARDLADTTTPFDKEGYALLKFH |
| Ga0310912_103846091 | 3300031941 | Soil | MVQVKSVSKAEAVKQQSRQLRGHIARDLADTSTPFDNEGYSLLKF |
| Ga0310912_114027291 | 3300031941 | Soil | MAQIDAISKPEAVKQQSRQLRGHIARDLADTTTPFD |
| Ga0310913_103236873 | 3300031945 | Soil | MAAIENVSKAEAIKQQSRQLRGNLARDLGETAAPFDNS |
| Ga0310910_113014462 | 3300031946 | Soil | MAIIERLSKAEAIKQQSRQLRGHLARDLADATAPFDND |
| Ga0306926_126725172 | 3300031954 | Soil | MVQINSVSKAEAVKQQSRQLRGHIARDLADTTVPFDNQGYS |
| Ga0318530_102419931 | 3300031959 | Soil | MAQIETISKAEAVKQQSRQLRGNIARDLADTTTPFDKEGYALLK |
| Ga0318545_101372991 | 3300032042 | Soil | MAAIENVSKAEAIKQQSRQLRGNLASDLADTATPFD |
| Ga0318558_102372111 | 3300032044 | Soil | MAAIENVSKAEAIKQQSRQLRGNLACDLAGTATPFDKVGYS |
| Ga0318533_105463841 | 3300032059 | Soil | VAQVESISKAEAVKQQSRQLRGHIARDLADMTVPFDKEEYSL |
| Ga0306924_108287761 | 3300032076 | Soil | MAQIETISKAEAVKQQSRQLRGHLTRDLADASAPFD |
| Ga0318577_105160391 | 3300032091 | Soil | MVQVDSVSKPEALKQQSRQLRGHIARDLADTSVPF |
| Ga0335081_109245941 | 3300032892 | Soil | VVQLVDKISKAEATKQQSRQLRGHLARDLIDTATPFDGEGYSLLKFH |
| Ga0335075_112723432 | 3300032896 | Soil | MAQLENISKAEAVKQQSRQLRGHIARDLAEPAHPF |
| Ga0335084_123594051 | 3300033004 | Soil | MAQVTTLSKAEAVKQQSRQLRGNLSRDLADTATAF |
| Ga0314872_024469_14_160 | 3300033810 | Peatland | VVQAVEKISKAEATKQQSRHLRGHLARDLADTATPFDGEGYSLLKFHE |
| ⦗Top⦘ |