


| Basic Information | |
|---|---|
| Family ID | F091525 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMDRE |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.00 % |
| % of genes near scaffold ends (potentially truncated) | 87.85 % |
| % of genes from short scaffolds (< 2000 bps) | 86.92 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.140 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.299 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.318 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.794 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 14.29% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13557 | Phenol_MetA_deg | 11.21 |
| PF10011 | DUF2254 | 2.80 |
| PF04392 | ABC_sub_bind | 1.87 |
| PF01226 | Form_Nir_trans | 1.87 |
| PF12787 | EcsC | 1.87 |
| PF01740 | STAS | 1.87 |
| PF00916 | Sulfate_transp | 1.87 |
| PF00216 | Bac_DNA_binding | 1.87 |
| PF03976 | PPK2 | 0.93 |
| PF00196 | GerE | 0.93 |
| PF03969 | AFG1_ATPase | 0.93 |
| PF00583 | Acetyltransf_1 | 0.93 |
| PF13592 | HTH_33 | 0.93 |
| PF09298 | FAA_hydrolase_N | 0.93 |
| PF09084 | NMT1 | 0.93 |
| PF05661 | DUF808 | 0.93 |
| PF00239 | Resolvase | 0.93 |
| PF13936 | HTH_38 | 0.93 |
| PF01988 | VIT1 | 0.93 |
| PF00291 | PALP | 0.93 |
| PF01648 | ACPS | 0.93 |
| PF07311 | Dodecin | 0.93 |
| PF04185 | Phosphoesterase | 0.93 |
| PF00119 | ATP-synt_A | 0.93 |
| PF07885 | Ion_trans_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 1.87 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.87 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 1.87 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 1.87 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 1.87 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.87 |
| COG0179 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.93 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1485 | Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.93 |
| COG2354 | Membrane protein MutK/YedI, may be involved in DNA repair | Replication, recombination and repair [L] | 0.93 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.93 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.14 % |
| Unclassified | root | N/A | 44.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02RT6CU | Not Available | 527 | Open in IMG/M |
| 3300000550|F24TB_11752136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10018591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1672 | Open in IMG/M |
| 3300000956|JGI10216J12902_102418532 | Not Available | 546 | Open in IMG/M |
| 3300003994|Ga0055435_10161560 | Not Available | 629 | Open in IMG/M |
| 3300004081|Ga0063454_101875387 | Not Available | 527 | Open in IMG/M |
| 3300004267|Ga0066396_10007780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1215 | Open in IMG/M |
| 3300004479|Ga0062595_100133966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300005295|Ga0065707_10533245 | Not Available | 733 | Open in IMG/M |
| 3300005332|Ga0066388_106921845 | Not Available | 571 | Open in IMG/M |
| 3300005435|Ga0070714_101244319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300005713|Ga0066905_100515019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300005764|Ga0066903_100911332 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300005764|Ga0066903_102935235 | Not Available | 924 | Open in IMG/M |
| 3300005764|Ga0066903_107872291 | Not Available | 547 | Open in IMG/M |
| 3300005764|Ga0066903_108581627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 520 | Open in IMG/M |
| 3300005764|Ga0066903_108920078 | Not Available | 508 | Open in IMG/M |
| 3300005937|Ga0081455_10008269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10848 | Open in IMG/M |
| 3300005937|Ga0081455_10209725 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300006057|Ga0075026_100401649 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300006057|Ga0075026_100843239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 559 | Open in IMG/M |
| 3300006059|Ga0075017_100583593 | Not Available | 853 | Open in IMG/M |
| 3300006086|Ga0075019_10187130 | Not Available | 1222 | Open in IMG/M |
| 3300006847|Ga0075431_100081026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 3351 | Open in IMG/M |
| 3300007788|Ga0099795_10349480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 661 | Open in IMG/M |
| 3300009839|Ga0116223_10520810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 691 | Open in IMG/M |
| 3300010046|Ga0126384_11682227 | Not Available | 599 | Open in IMG/M |
| 3300010159|Ga0099796_10320622 | Not Available | 661 | Open in IMG/M |
| 3300010358|Ga0126370_12395971 | Not Available | 524 | Open in IMG/M |
| 3300010359|Ga0126376_13111761 | Not Available | 513 | Open in IMG/M |
| 3300010375|Ga0105239_11136526 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300010379|Ga0136449_103996178 | Not Available | 551 | Open in IMG/M |
| 3300011444|Ga0137463_1181233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300012202|Ga0137363_10349753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → unclassified Pseudobdellovibrionaceae → Pseudobdellovibrionaceae bacterium | 1223 | Open in IMG/M |
| 3300012355|Ga0137369_10311548 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300012948|Ga0126375_10212481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1280 | Open in IMG/M |
| 3300014299|Ga0075303_1002217 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300014321|Ga0075353_1073488 | Not Available | 754 | Open in IMG/M |
| 3300015200|Ga0173480_10577851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 686 | Open in IMG/M |
| 3300015371|Ga0132258_13891029 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300015372|Ga0132256_103002237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300015373|Ga0132257_101131703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300016270|Ga0182036_11350331 | Not Available | 596 | Open in IMG/M |
| 3300016357|Ga0182032_10394640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300016357|Ga0182032_11462128 | Not Available | 593 | Open in IMG/M |
| 3300016371|Ga0182034_10712794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300016387|Ga0182040_10550529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 928 | Open in IMG/M |
| 3300016445|Ga0182038_11003634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300016445|Ga0182038_11246112 | Not Available | 664 | Open in IMG/M |
| 3300016445|Ga0182038_11391822 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300017974|Ga0187777_10290844 | Not Available | 1115 | Open in IMG/M |
| 3300018064|Ga0187773_10404386 | Not Available | 791 | Open in IMG/M |
| 3300018085|Ga0187772_11289582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 540 | Open in IMG/M |
| 3300020199|Ga0179592_10350659 | Not Available | 650 | Open in IMG/M |
| 3300021178|Ga0210408_11091791 | Not Available | 614 | Open in IMG/M |
| 3300021401|Ga0210393_11436803 | Not Available | 550 | Open in IMG/M |
| 3300021560|Ga0126371_10365067 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300021560|Ga0126371_11348248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 846 | Open in IMG/M |
| 3300025916|Ga0207663_10246507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
| 3300026557|Ga0179587_10683267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 676 | Open in IMG/M |
| 3300026557|Ga0179587_11187075 | Not Available | 502 | Open in IMG/M |
| 3300027880|Ga0209481_10667902 | Not Available | 539 | Open in IMG/M |
| 3300027915|Ga0209069_10446150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 718 | Open in IMG/M |
| 3300028796|Ga0307287_10342504 | Not Available | 564 | Open in IMG/M |
| 3300028885|Ga0307304_10346663 | Not Available | 663 | Open in IMG/M |
| 3300031184|Ga0307499_10345251 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031226|Ga0307497_10332640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 706 | Open in IMG/M |
| 3300031231|Ga0170824_101090635 | Not Available | 985 | Open in IMG/M |
| 3300031573|Ga0310915_10700030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300031640|Ga0318555_10533135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300031680|Ga0318574_10835488 | Not Available | 539 | Open in IMG/M |
| 3300031724|Ga0318500_10544795 | Not Available | 585 | Open in IMG/M |
| 3300031744|Ga0306918_10500134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300031747|Ga0318502_10570563 | Not Available | 680 | Open in IMG/M |
| 3300031748|Ga0318492_10240160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300031748|Ga0318492_10632204 | Not Available | 572 | Open in IMG/M |
| 3300031763|Ga0318537_10030882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1906 | Open in IMG/M |
| 3300031768|Ga0318509_10268488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300031780|Ga0318508_1226598 | Not Available | 536 | Open in IMG/M |
| 3300031792|Ga0318529_10243595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
| 3300031819|Ga0318568_10056254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2282 | Open in IMG/M |
| 3300031846|Ga0318512_10174787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300031879|Ga0306919_10054757 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300031880|Ga0318544_10215899 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300031890|Ga0306925_10519852 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300031890|Ga0306925_11944745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300031910|Ga0306923_11698625 | Not Available | 652 | Open in IMG/M |
| 3300031910|Ga0306923_12150408 | Not Available | 561 | Open in IMG/M |
| 3300031912|Ga0306921_10045915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4947 | Open in IMG/M |
| 3300031945|Ga0310913_10176356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300031945|Ga0310913_10456403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
| 3300031946|Ga0310910_11001704 | Not Available | 653 | Open in IMG/M |
| 3300032039|Ga0318559_10463037 | Not Available | 591 | Open in IMG/M |
| 3300032043|Ga0318556_10199600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300032052|Ga0318506_10007513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3471 | Open in IMG/M |
| 3300032068|Ga0318553_10267143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300032076|Ga0306924_11310417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300032261|Ga0306920_100499875 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300032805|Ga0335078_10919684 | Not Available | 1048 | Open in IMG/M |
| 3300034819|Ga0373958_0208112 | Not Available | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 1.87% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026947 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_06202690 | 2070309004 | Green-Waste Compost | RKIQKARSLALNGTNGPLHWRDLQIGGAVVPPGAQPDDRVEFVVPIDRE |
| prs_05262820 | 2070309004 | Green-Waste Compost | MGVHGPLLWRDLQTGGGVLPAGAKPDHAVEFHFPMDGQNKARG |
| F24TB_117521362 | 3300000550 | Soil | LILNGVHGPLQWRDLQIGGAVVPAGARLEDYVEFHVPIDAKK* |
| AF_2010_repII_A001DRAFT_100185913 | 3300000793 | Forest Soil | VLALNGIHGPLQWRDLQTGGTVLTPGATLDDPVEFIVQMDRE* |
| JGI10216J12902_1024185321 | 3300000956 | Soil | SLYGVDGALHWRDLQIEGHVLPASATADDPVEFIVSMD* |
| Ga0055435_101615602 | 3300003994 | Natural And Restored Wetlands | ILNGVRGPLQWRDLQTGGAVIPPGVTLEDPVEFIVPMDRE* |
| Ga0063454_1018753871 | 3300004081 | Soil | RVVLILNGVHGPLQWSDLQTSGAVIPHGVQSDDPVEFNVSMDRQ* |
| Ga0066396_100077802 | 3300004267 | Tropical Forest Soil | PFLQSFMEVRIERSRRRVVLALNGVHGPLQWRDLQTGGTVPPPGATLDDPVEFVVQMDRE |
| Ga0062595_1001339661 | 3300004479 | Soil | VVLALNGVDGPLYWRDLQTGGAILPPNATPDDPVEFVVHMDSD* |
| Ga0065707_105332451 | 3300005295 | Switchgrass Rhizosphere | RRVVLALNGVDGPLYWRDLQTGGAILPPNATPDDPVEFVVQMDSD* |
| Ga0066388_1069218451 | 3300005332 | Tropical Forest Soil | RRVVLALNGVHGPLRWQDLQIGGALLPPNVGLGAPVEFIVQMD* |
| Ga0070667_1006799792 | 3300005367 | Switchgrass Rhizosphere | LNGVDGPLRWRDLQIGGAAFPAGASLSDPVEFVVPMDRD* |
| Ga0070714_1012443191 | 3300005435 | Agricultural Soil | LILNGVDGPLRWRDLQTGGASFPAGSSLSDPVEFIVPMDRE* |
| Ga0066905_1005150192 | 3300005713 | Tropical Forest Soil | SKRRVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMDRE* |
| Ga0066903_1009113322 | 3300005764 | Tropical Forest Soil | GVDGPLRWRDLQIDGAVMPAGRAPDDPVEFVVPMDHE* |
| Ga0066903_1029352351 | 3300005764 | Tropical Forest Soil | VLNGVDGPLHWRDLETGGAVIPPNRALDDPVEFIVPMDSK* |
| Ga0066903_1078722912 | 3300005764 | Tropical Forest Soil | LVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVQMDRE* |
| Ga0066903_1085816272 | 3300005764 | Tropical Forest Soil | VHGPLQWRDLETGGAVIPPGVTLDDPVEFVVSMDRQ* |
| Ga0066903_1089200781 | 3300005764 | Tropical Forest Soil | RVERSKKRVVLILNGVHGPLQWRDLETGGAVIRPGVTLDDPVEFVVSMDGQ* |
| Ga0081455_1000826915 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VVLALNGIHGPLQWRDLQTGGAVLPLGATLDDPVEFIVQMDRE* |
| Ga0081455_102097254 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VVLVPNRTHGPLQWRDLQTGGTVLPSGGSLDDPAEFIVQMDRE* |
| Ga0075026_1004016491 | 3300006057 | Watersheds | VVLILNGVHGPLQWSDLQTSGAVIPLGVKPDDPVEFIVSMDRQ* |
| Ga0075026_1008432392 | 3300006057 | Watersheds | IVLALYGVDGSLRWRDLQIGGDVLPASATVDDPVEFIVSMD* |
| Ga0075017_1005835931 | 3300006059 | Watersheds | SKKRVVLVLNGVHGPLRWRDLQTGGAVIPLGAKPDDPVEFIVSMDRQ* |
| Ga0075019_101871302 | 3300006086 | Watersheds | ILNGVHGPLQWSDLQTSGAVIPLGVKPDDPVEFIVSMDRQ* |
| Ga0075431_1000810265 | 3300006847 | Populus Rhizosphere | NRVVFALHGIDGPLRWRDLDMRGAVVPEGVTPDGPVEFVVPSQGK* |
| Ga0099795_103494802 | 3300007788 | Vadose Zone Soil | EVRIERSKKRVVLILNGVHGPLQWSDLQASGAVIPLGVKPDDPVEFIVSMDRQ* |
| Ga0116223_105208102 | 3300009839 | Peatlands Soil | RVERSKRRVALILHGVQGPLHWRDLQIGGGVLPPNATLDDPVEFLVSMDRD* |
| Ga0126384_116822272 | 3300010046 | Tropical Forest Soil | SKKRVVLILNGVHGPLQWRDLETGGAVIPPGVTLDDPVEFVVSMDRQ* |
| Ga0099796_103206221 | 3300010159 | Vadose Zone Soil | GVHGPLQWSDLQTSGAVISLGMKPDDPVEFIVSMDRQ* |
| Ga0126370_123959711 | 3300010358 | Tropical Forest Soil | VVLVLNGTHGPLQWRDLQTGGTVLPSGASLDNLLEFIVQMDRE* |
| Ga0126376_131117612 | 3300010359 | Tropical Forest Soil | RVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVQMHRE* |
| Ga0105239_111365262 | 3300010375 | Corn Rhizosphere | HGPLQWRDLQTGGAVIPPGVTLDDPVEFVVPMDRQ* |
| Ga0136449_1039961781 | 3300010379 | Peatlands Soil | LILHGVQGPLHWRDLQIGGDVLPPGATLDGPAEFLVPMDHD* |
| Ga0137463_11812332 | 3300011444 | Soil | RVERSKKRVVLILNGVHGPLQWSDLQTGGAVIPPGVKPDDPVEFIVSMDRQ* |
| Ga0137363_103497531 | 3300012202 | Vadose Zone Soil | MEVRIERSKKRVVLILNGVHGPLQWSDLQASGAVIPLGAKPDDPVEFIVSMDRQ* |
| Ga0137369_103115482 | 3300012355 | Vadose Zone Soil | IHGPLQWRDLQTGGTVLPPGATLDDPAEFIVQMDRE* |
| Ga0126375_102124813 | 3300012948 | Tropical Forest Soil | KKRVVLILNGVHGPLQWRDLETGGAVIPPGVTLDDPVEFVVSMDRQ* |
| Ga0075303_10022172 | 3300014299 | Natural And Restored Wetlands | MEVRVEHSRKRVVLILNGVHGPPQWRDLKTGGAVIPPDVTLEDPVEFIVPMDRE* |
| Ga0075353_10734882 | 3300014321 | Natural And Restored Wetlands | VLILNGVHGPLQWRDLQTGGAVIPPGVTLEDPVEFIVPMDRE* |
| Ga0173480_105778512 | 3300015200 | Soil | LNGIHGPLQWRDLQTGGTVRPPSGTLDDPVEFIVPMDRE* |
| Ga0132258_138910291 | 3300015371 | Arabidopsis Rhizosphere | ERSKKRVVLILNGVHGPLQWRDLQTGGAVIPPGVTLDGPVEFVVPMDRQ* |
| Ga0132256_1030022371 | 3300015372 | Arabidopsis Rhizosphere | MALDGIHGPLQWRDLQTGGTRLPPGRKPHDPVEFTVPTDRE* |
| Ga0132257_1011317032 | 3300015373 | Arabidopsis Rhizosphere | SKRRVVLVLNGIHGPLQWRDLQTGGTVRPPSGTLDDPVEFIVPMDRE* |
| Ga0182036_113503312 | 3300016270 | Soil | VLALNGAHGPLQWRDLQTGGAVLPPGATFDDPVEFIVPMQRE |
| Ga0182032_103946401 | 3300016357 | Soil | KRRVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDSVEFIVQMDRE |
| Ga0182032_114621282 | 3300016357 | Soil | GVDGPLHWRDLQTGGAVLPSEANEDGPVEFTVTMD |
| Ga0182034_107127942 | 3300016371 | Soil | LTLYGVDGPLHWRDLQTGGVVLPPEANQDGPVEFTVPME |
| Ga0182040_105505291 | 3300016387 | Soil | RVVVVLNGTDGPLHWRDLQTGGAVLPSEAQSDSPVEFIVPFL |
| Ga0182038_110036342 | 3300016445 | Soil | LILNGVSGPLRWRDLQIGGAVLSPDVTLDAPVEFIVPMERDSAG |
| Ga0182038_112461122 | 3300016445 | Soil | LVLYGVDGPLRWRDLQIGGAALPASETADDPVEFIVSMD |
| Ga0182038_113918222 | 3300016445 | Soil | VLVLYGVDGPLHWRDLQIGGAALPASETADDPVEFIVSMD |
| Ga0187777_102908442 | 3300017974 | Tropical Peatland | VERSKRRVVLTLYGVDGPLHWRDLQTGGTVLPPEANQDGPVEFAIPMD |
| Ga0187773_104043861 | 3300018064 | Tropical Peatland | KRRVALILNGVRGPLHWRDLQVGGNLLPLNAMLDDPVEFLVPMDRD |
| Ga0187772_112895821 | 3300018085 | Tropical Peatland | LILHGVQGQLLWRDLQIGGEVLPPGATLDDPVEFLVPMDRD |
| Ga0190272_118864862 | 3300018429 | Soil | VEGPLHWRDLEIRGAVLPDGAKPDDPVEFNVPYRRN |
| Ga0179592_103506591 | 3300020199 | Vadose Zone Soil | ILNGVHGPLQWSDLQASGAVIPLGAKPDDQVEFIVSMDRQ |
| Ga0210408_110917911 | 3300021178 | Soil | LVLNGVHGPLRWRDLQTGGAVIPLGTKPDDPVEFIVSMDRQ |
| Ga0210393_114368031 | 3300021401 | Soil | NGVHGPLRWRDLQTGGAVIPLGAKPDDPVEFIVSMDRQ |
| Ga0126371_103650671 | 3300021560 | Tropical Forest Soil | KRVVLILNGVHGPLQWRDLQIGGAVIPAGAKPDDYVEFHVPMDGHK |
| Ga0126371_113482481 | 3300021560 | Tropical Forest Soil | LYGVDGPLHWRDLQTGGAVLPPEANQDGPVEFTVPME |
| Ga0207663_102465071 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLNGIHGPLQWRDLEIGGTVLPAGATPDDPIEFVVPMGRE |
| Ga0179587_106832672 | 3300026557 | Vadose Zone Soil | VVLILNGVHGPLQWSDLQASGAVIPLGAKPDDPVEFIVSMDRQ |
| Ga0179587_111870751 | 3300026557 | Vadose Zone Soil | VRIERSKKRVVLILNGVHGPLQWSDLQASGAVIPLGAKPDDQVEFIVSMDRQ |
| Ga0207853_10222772 | 3300026947 | Tropical Forest Soil | NGPLRWRDLQIGGAVVPPGAQSDDRVEFVVPIDRE |
| Ga0209481_106679022 | 3300027880 | Populus Rhizosphere | RVERSKRRVVLVLNGIHGPLRWADLQTGGSVVPAGATPDSPVEFIVPMDGS |
| Ga0209069_104461501 | 3300027915 | Watersheds | LYGVDGSLRWRDLQIGGDVLPASATVDDPVEFIVSMD |
| Ga0307287_103425041 | 3300028796 | Soil | NGVHGPLQWRDLQTGGAVIPSGVTLDDPAEFIVSMDRQ |
| Ga0307304_103466632 | 3300028885 | Soil | KRVVLILNGVHGPLQWRDLQTGGAVIPSGVTLDDPAEFIVSMDRQ |
| Ga0307499_103452511 | 3300031184 | Soil | EVRIERSKKRVVLILNGVHGPLQWSDLQANGAVIPLGVKPDDPVEFIVSMDRQ |
| Ga0307497_103326402 | 3300031226 | Soil | LILNGVHGPLQWRDLQTGGAVIPSGVTLDDPAEFIVSMDRQ |
| Ga0170824_1010906352 | 3300031231 | Forest Soil | SKKRVVLILNGVHGPLQWRDLETGGAAIPPGVKPDDPVEFIVPMDRQ |
| Ga0310915_107000301 | 3300031573 | Soil | RVALVLNGTHGPLHWRDLQTGGTVLPSGASLDDPVEFIVPMDRE |
| Ga0318555_105331351 | 3300031640 | Soil | NGTHGPLQWRDLQTGGTVLPSGASLDDPIEFIVQMDRE |
| Ga0318574_108354881 | 3300031680 | Soil | LVLNGTHGPLQWRDLQAGGTVLPSGASLDDPVEFIVQMDRE |
| Ga0318500_105447951 | 3300031724 | Soil | VERSKRRMVLVLNGIHGPLQWRDLQTGGTVLPSGASLDDPVEFIVEMDRE |
| Ga0306918_105001341 | 3300031744 | Soil | KRVVLTLHGVDGPLRWRDLQTGGAVLPPEANQDGLVEFTVPMD |
| Ga0318502_105705632 | 3300031747 | Soil | VLVLNGIHGPLQWRDLQTGGTVLPSGASLDDPVEFIVEMDRE |
| Ga0318492_102401601 | 3300031748 | Soil | NGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMNRE |
| Ga0318492_106322041 | 3300031748 | Soil | KRVVLILNGVHGPLQWRDLQIGGAVIPANARLDDYVEFHVPMDGH |
| Ga0318537_100308821 | 3300031763 | Soil | VLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVQMDRE |
| Ga0318509_102684881 | 3300031768 | Soil | THGPLQWRDLQTGGTVPPSGASLDDPIEFIVQMDRE |
| Ga0318508_12265981 | 3300031780 | Soil | VHGPLQWRDLQTSGTVAPADATLDDPVEFIVPMDP |
| Ga0318529_102435952 | 3300031792 | Soil | SKRRVVLTLYGVDGPLHWRDLQTGGVVLPPEANQDGPVEFTVPME |
| Ga0318568_100562541 | 3300031819 | Soil | SKRRVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMDRE |
| Ga0318512_101747873 | 3300031846 | Soil | ERSKRRVVLTLYGVDGPLHWRDLQTGGAVLPPEANQDGPVEFTVPME |
| Ga0306919_100547574 | 3300031879 | Soil | VLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMDRE |
| Ga0318544_102158991 | 3300031880 | Soil | LILNGVHGPLQWRDLQIGGAVIPANARLDDYVEFHVPMDGH |
| Ga0306925_105198521 | 3300031890 | Soil | LNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMDRE |
| Ga0306925_119447451 | 3300031890 | Soil | LNGTHGPLQWRDLQTGGTVLPSGASLDDSVEFIVQMDRE |
| Ga0306923_116986251 | 3300031910 | Soil | VLILNDVHGPLHWRDLQTGGTVRPPGATLDDPVEFIVPMDGE |
| Ga0306923_121504081 | 3300031910 | Soil | VVLVLNGTHGPLQWRDLQTGGTVLPSAASLDDPVEFIVQMNRE |
| Ga0306921_100459157 | 3300031912 | Soil | RVERTKKRLVLILNDVHGPLHWRDLQTGGTVRPPGATLDDPVEFIVPMDGE |
| Ga0310912_107307262 | 3300031941 | Soil | NGTNGPLRWRDLQIGGAVVPTGAQPDDRVEFVVPIDRE |
| Ga0310913_101763562 | 3300031945 | Soil | ERSKRRVVLVLNGIHGPLQWRDLQTGGTVLPSGASLDDPVEFIVEMDRE |
| Ga0310913_104564032 | 3300031945 | Soil | SKRRVVLILNGTHGPLQWRDLQTGGTVLPSGASLDGSVEFIVRMDHQ |
| Ga0310910_110017041 | 3300031946 | Soil | THGPLQWRDLQTGGTVLPPGVSLDDPVEFIVQMDRE |
| Ga0310910_113909011 | 3300031946 | Soil | VLALNGTNGPLHWRDLQIGGAVVPPGAQPDDRVEFVVPIDRE |
| Ga0318559_104630372 | 3300032039 | Soil | VLALNGAHGPVQWRDLQTGGAVLPPGGTFDDPVEFIVPMPRE |
| Ga0318556_101996001 | 3300032043 | Soil | SKRRVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPIEFIVQMDRE |
| Ga0318506_100075134 | 3300032052 | Soil | SKRRVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMNRE |
| Ga0318553_102671431 | 3300032068 | Soil | VLVLNGTHGPLQWRDLQTGGTVLPSGASLEDPVEFIVQMDRE |
| Ga0306924_113104172 | 3300032076 | Soil | RGPLKWHDLQIGGAVLPPGGSLDDPVEFMVPMDRE |
| Ga0306920_1004998754 | 3300032261 | Soil | ERSKRRVVLVLNGTHGPLQWRDLQTGGTVLPSGASLDDPVEFIVPMDRE |
| Ga0335078_109196842 | 3300032805 | Soil | RRVVLTLYGVDGPLHWRDLQTGGTVLPPEANQDDPVEFAVPMD |
| Ga0318519_104369491 | 3300033290 | Soil | TIGPLHWRDLQIGGAVPPPGAQPDDRVEFVVPIDRE |
| Ga0373958_0208112_1_111 | 3300034819 | Rhizosphere Soil | IHGPLQWRDLEIGGTVLPAGATPDDPIEFVVPMGRE |
| ⦗Top⦘ |