


| Basic Information | |
|---|---|
| Family ID | F091519 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PDGYTWMVGTHKAEPTAKEMKKGMEEMMKQQPAGAAAAD |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.80 % |
| % of genes near scaffold ends (potentially truncated) | 96.26 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.374 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.822 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.598 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF11799 | IMS_C | 28.04 |
| PF14542 | Acetyltransf_CG | 9.35 |
| PF00575 | S1 | 2.80 |
| PF14697 | Fer4_21 | 1.87 |
| PF11798 | IMS_HHH | 1.87 |
| PF14534 | DUF4440 | 1.87 |
| PF13411 | MerR_1 | 1.87 |
| PF13561 | adh_short_C2 | 0.93 |
| PF02469 | Fasciclin | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF07238 | PilZ | 0.93 |
| PF03150 | CCP_MauG | 0.93 |
| PF13360 | PQQ_2 | 0.93 |
| PF01435 | Peptidase_M48 | 0.93 |
| PF02954 | HTH_8 | 0.93 |
| PF01566 | Nramp | 0.93 |
| PF02195 | ParBc | 0.93 |
| PF01590 | GAF | 0.93 |
| PF01011 | PQQ | 0.93 |
| PF12681 | Glyoxalase_2 | 0.93 |
| PF13450 | NAD_binding_8 | 0.93 |
| PF00121 | TIM | 0.93 |
| PF01797 | Y1_Tnp | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.93 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.37 % |
| Unclassified | root | N/A | 19.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005178|Ga0066688_10309117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300005293|Ga0065715_11063971 | Not Available | 523 | Open in IMG/M |
| 3300005347|Ga0070668_100289495 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300005434|Ga0070709_11786662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005542|Ga0070732_10017230 | All Organisms → cellular organisms → Bacteria | 4043 | Open in IMG/M |
| 3300005542|Ga0070732_10503485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 734 | Open in IMG/M |
| 3300005598|Ga0066706_10016447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4332 | Open in IMG/M |
| 3300005598|Ga0066706_10774772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300005616|Ga0068852_101377333 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005842|Ga0068858_100699393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300006028|Ga0070717_11013407 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006032|Ga0066696_11012651 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006162|Ga0075030_101212381 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006162|Ga0075030_101220100 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300006852|Ga0075433_10037225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4196 | Open in IMG/M |
| 3300006881|Ga0068865_100662145 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300006954|Ga0079219_10691047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 773 | Open in IMG/M |
| 3300007076|Ga0075435_101902573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300009012|Ga0066710_102078207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300009038|Ga0099829_10747813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300009088|Ga0099830_10074555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2470 | Open in IMG/M |
| 3300009089|Ga0099828_11239269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009137|Ga0066709_100519446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1680 | Open in IMG/M |
| 3300009137|Ga0066709_100690354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
| 3300009174|Ga0105241_10323758 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300009177|Ga0105248_12379552 | Not Available | 603 | Open in IMG/M |
| 3300009523|Ga0116221_1011855 | All Organisms → cellular organisms → Bacteria | 4994 | Open in IMG/M |
| 3300009630|Ga0116114_1015580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2356 | Open in IMG/M |
| 3300009672|Ga0116215_1022705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2916 | Open in IMG/M |
| 3300009698|Ga0116216_10385300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 851 | Open in IMG/M |
| 3300009698|Ga0116216_10436147 | Not Available | 794 | Open in IMG/M |
| 3300010048|Ga0126373_12688364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300010366|Ga0126379_10586754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300010366|Ga0126379_11225906 | Not Available | 856 | Open in IMG/M |
| 3300010366|Ga0126379_12099150 | Not Available | 667 | Open in IMG/M |
| 3300010366|Ga0126379_12708255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300010376|Ga0126381_103521358 | Not Available | 615 | Open in IMG/M |
| 3300010379|Ga0136449_100737423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1643 | Open in IMG/M |
| 3300010379|Ga0136449_103659057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300010398|Ga0126383_11561246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 749 | Open in IMG/M |
| 3300010400|Ga0134122_10005653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9241 | Open in IMG/M |
| 3300011120|Ga0150983_13463239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 906 | Open in IMG/M |
| 3300012189|Ga0137388_10727375 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012189|Ga0137388_11367264 | Not Available | 647 | Open in IMG/M |
| 3300012202|Ga0137363_10411491 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300012208|Ga0137376_10080499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2729 | Open in IMG/M |
| 3300012350|Ga0137372_10760356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300012351|Ga0137386_10618313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300012357|Ga0137384_10511313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300012359|Ga0137385_10737829 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012362|Ga0137361_10662211 | Not Available | 955 | Open in IMG/M |
| 3300012362|Ga0137361_10989541 | Not Available | 760 | Open in IMG/M |
| 3300012918|Ga0137396_10949235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300012929|Ga0137404_10510308 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300012944|Ga0137410_10362953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300012971|Ga0126369_12362363 | Not Available | 618 | Open in IMG/M |
| 3300012971|Ga0126369_13680561 | Not Available | 502 | Open in IMG/M |
| 3300013296|Ga0157374_12652457 | Not Available | 529 | Open in IMG/M |
| 3300013306|Ga0163162_10685974 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300014052|Ga0120109_1034690 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300014325|Ga0163163_11023562 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300016294|Ga0182041_12158302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300016357|Ga0182032_11271673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300016404|Ga0182037_10171729 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300017943|Ga0187819_10497135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300017961|Ga0187778_10969360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300017970|Ga0187783_10243014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300019786|Ga0182025_1042706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300020579|Ga0210407_10159107 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Catalimonadaceae → Tunicatimonas → unclassified Tunicatimonas → Tunicatimonas sp. TK19036 | 1744 | Open in IMG/M |
| 3300021433|Ga0210391_10815216 | Not Available | 729 | Open in IMG/M |
| 3300021560|Ga0126371_11375969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300022533|Ga0242662_10341137 | Not Available | 509 | Open in IMG/M |
| 3300022724|Ga0242665_10391405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300025906|Ga0207699_11372066 | Not Available | 523 | Open in IMG/M |
| 3300025911|Ga0207654_10158717 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300025927|Ga0207687_10246482 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300025927|Ga0207687_11047647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300025981|Ga0207640_10612056 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300026035|Ga0207703_10714960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300026118|Ga0207675_100796434 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300026530|Ga0209807_1104902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300026557|Ga0179587_10228535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300026895|Ga0207758_1006991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 1213 | Open in IMG/M |
| 3300027604|Ga0208324_1126737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300027662|Ga0208565_1006881 | All Organisms → cellular organisms → Bacteria | 4953 | Open in IMG/M |
| 3300027867|Ga0209167_10356633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 795 | Open in IMG/M |
| 3300027903|Ga0209488_11058592 | Not Available | 557 | Open in IMG/M |
| 3300027910|Ga0209583_10695076 | Not Available | 529 | Open in IMG/M |
| 3300027911|Ga0209698_10095361 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300027986|Ga0209168_10039934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2552 | Open in IMG/M |
| 3300028016|Ga0265354_1027106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300028047|Ga0209526_10172425 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300030878|Ga0265770_1017551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300031679|Ga0318561_10849686 | Not Available | 502 | Open in IMG/M |
| 3300031715|Ga0307476_10365263 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300031753|Ga0307477_10632335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300031754|Ga0307475_10759661 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031820|Ga0307473_10246315 | Not Available | 1093 | Open in IMG/M |
| 3300031859|Ga0318527_10370680 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031879|Ga0306919_10157368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1662 | Open in IMG/M |
| 3300031890|Ga0306925_11459107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiota incertae sedis → Methylacidimicrobium → Methylacidimicrobium cyclopophantes | 672 | Open in IMG/M |
| 3300031912|Ga0306921_10189428 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300031942|Ga0310916_11502663 | Not Available | 549 | Open in IMG/M |
| 3300032042|Ga0318545_10312227 | Not Available | 565 | Open in IMG/M |
| 3300032160|Ga0311301_10512279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1773 | Open in IMG/M |
| 3300032261|Ga0306920_100512377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1780 | Open in IMG/M |
| 3300033412|Ga0310810_10260835 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.35% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066688_103091173 | 3300005178 | Soil | DPDGYTWMVGTHKAEPTAKKMKEKMLEMMRQQPAGAATAA* |
| Ga0065715_110639712 | 3300005293 | Miscanthus Rhizosphere | VVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMGQQSAGAATVAA* |
| Ga0070668_1002894951 | 3300005347 | Switchgrass Rhizosphere | DPDGYGWTVGTHKAEPTIQEMKKKMAEQIGQQPAGTATVAA* |
| Ga0070709_117866621 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PDGYTWMVGTHKAEPTAKEMKKGMEEMMKQQPAGAAAAD* |
| Ga0070732_100172307 | 3300005542 | Surface Soil | SWMVGTHKAEPSAKEMKKGMQEMMKQQPAGAAAAD* |
| Ga0070732_105034851 | 3300005542 | Surface Soil | DGYSWMVGTHKAEPSAKEMKKGMEEMMKQQPAGAAAAD* |
| Ga0066706_100164477 | 3300005598 | Soil | DGYTWTVGTHKAEPTAKEMKEKMREMMRQQPADTATAA* |
| Ga0066706_107747721 | 3300005598 | Soil | CGTIVDPDGYAWMVGTHKAEPTAKEMKKKMQEQIGAQPAGTATAA* |
| Ga0068852_1013773331 | 3300005616 | Corn Rhizosphere | PDGYAWMVGTHKAEPTAREMNKKMAEQMEQQSTGTPTAA* |
| Ga0068858_1006993932 | 3300005842 | Switchgrass Rhizosphere | DGYAWMVGTHKAEPTAREMNKKMAEQMEQQSTGTPTAA* |
| Ga0070717_110134071 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GYSWMVGTHKAEPSAKEMKKNMLAQMKQQGTTSATAA* |
| Ga0066696_110126512 | 3300006032 | Soil | GDRCGKIVDPDGYSWMVGTHKAEPSAKEMKKKMLEQMKQMRPQQASTAA* |
| Ga0075030_1012123812 | 3300006162 | Watersheds | DPDGYAWMVGTHKAEPTAKEMKKGMEEMMKQQPAGAVAAD* |
| Ga0075030_1012201003 | 3300006162 | Watersheds | VDPDGYNWMVGTHKAEPTAKEMKKGMLEMMKAMKEQPGSAAAD* |
| Ga0075433_100372253 | 3300006852 | Populus Rhizosphere | GYTWMVGTHKAEPTAKEMKKGMEEMMKQQPSSAAAD* |
| Ga0068865_1006621452 | 3300006881 | Miscanthus Rhizosphere | VLDRDGYSWMVGTHKAEPSAKEMKKGMEEMMRQSRPEGAAAAD* |
| Ga0079219_106910472 | 3300006954 | Agricultural Soil | DPDGYTWMVGTHKAEPTAKEMKKGMLEMMKTMKQQPGSAVAAD* |
| Ga0075435_1019025731 | 3300007076 | Populus Rhizosphere | WMVGTHKAEPSVKEMKQKMAEMMKQQSAGAAAAD* |
| Ga0066710_1020782071 | 3300009012 | Grasslands Soil | PDGYAWMVGTHKAEPTAKEMKKKMQEQIGAQPAGTATAA |
| Ga0099829_107478131 | 3300009038 | Vadose Zone Soil | MVVDPDGYSWMVGTHKAEPTSQQMKKKMVEQMKQQPTSTATAA* |
| Ga0099830_100745555 | 3300009088 | Vadose Zone Soil | YGWMVGTHKAEPTTQEMKKKMAEQMRQPADVATAA* |
| Ga0099828_112392692 | 3300009089 | Vadose Zone Soil | DRCGTIVDPDGYSWMVGTHKAEPTAKEMKEKMLEMMRQQPTGAAAAD* |
| Ga0066709_1005194461 | 3300009137 | Grasslands Soil | PDGYAWMVGTHKAEPTAKEMKKKMQEQIGAQPAGTATAA* |
| Ga0066709_1006903541 | 3300009137 | Grasslands Soil | DGYAWMVGTHKAEPTAKEMKKKMQEQIGAQPAGTATAA* |
| Ga0105241_103237581 | 3300009174 | Corn Rhizosphere | KAFMFWCDRCGVVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMGQQSAGAATVAA* |
| Ga0105248_123795521 | 3300009177 | Switchgrass Rhizosphere | DGYGWTVGTHKAEPTTQEMKRKMAEQVAQQPADATTVAA* |
| Ga0116221_10118555 | 3300009523 | Peatlands Soil | MVGTHKVEPTAKEMKKGMLEMMRQQQTDTATATAA* |
| Ga0116114_10155801 | 3300009630 | Peatland | PDGYSWMVGTHKAEPTAKEMKKGMLEMMRQQPTDTATAA* |
| Ga0116215_10227051 | 3300009672 | Peatlands Soil | DGYSWMVGTHKVEPTAKEMKKGMLEMMRQQQTDTATATAA* |
| Ga0116216_103853001 | 3300009698 | Peatlands Soil | GYPWMVGTHKAEPTAKEMKKGMLEMMRQQPTDAATAA* |
| Ga0116216_104361471 | 3300009698 | Peatlands Soil | WMVGTHKVEPTLREMKKRMKEQMREQSARAPGPA* |
| Ga0126373_126883643 | 3300010048 | Tropical Forest Soil | VDPDGYSWMVGTHKAEPSAKEMKKGMEEMMKRQPPAIAAAD* |
| Ga0126379_105867542 | 3300010366 | Tropical Forest Soil | GYAWMVGTHKAEPTTKEMKKGMEEMMKQQPPGAAAAD* |
| Ga0126379_112259061 | 3300010366 | Tropical Forest Soil | PDGYMWMVATHKAEPSAREMKARMEEQMRQMSAHATTAA* |
| Ga0126379_120991503 | 3300010366 | Tropical Forest Soil | YSWMVATHKAEPTAREMKQKMMEMMRQQSTAAAA* |
| Ga0126379_127082552 | 3300010366 | Tropical Forest Soil | DPDGYTWMVGTHKAEPSAKEMKKGIEEMMKQQPSTAAAD* |
| Ga0126381_1035213581 | 3300010376 | Tropical Forest Soil | LDGYTWMVATHKAEPSAREMKAKMEEQMRQMSAHATTAA* |
| Ga0136449_1007374233 | 3300010379 | Peatlands Soil | DPDGYPWMVGTHKAEPTAKEMKKGMLEMMRQQPTGTSAAA* |
| Ga0136449_1036590572 | 3300010379 | Peatlands Soil | PDGYPWMVGTHKAEPTAKEMKKGMLEMMRQQPTDTATAA* |
| Ga0126383_115612461 | 3300010398 | Tropical Forest Soil | IVDPDGYTWTVGTHKAEPTAKAMKEKMLEMMGQHPASAVTAD* |
| Ga0134122_100056536 | 3300010400 | Terrestrial Soil | MFWCDRCGVVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMGQQSAGAATVAA* |
| Ga0150983_134632391 | 3300011120 | Forest Soil | PDGYPWMVGTHKAEPSAKEMKKGMLEMMRQPPTDTATAA* |
| Ga0137388_107273752 | 3300012189 | Vadose Zone Soil | CGTIVDPDGIYVNDRNPKAEPTAKEMKEKMLEQMRQQPAGAATAA* |
| Ga0137388_113672642 | 3300012189 | Vadose Zone Soil | VVDPDGYGWMVGTHKAEPTTQEMKKKMTEQMGQQPADTATVAA* |
| Ga0137363_104114912 | 3300012202 | Vadose Zone Soil | VDPDGYAWMVGTHKAEPTAKEMKKGMEEMMKHQPTGAAAAD* |
| Ga0137376_100804994 | 3300012208 | Vadose Zone Soil | DPDGYTWMVGTHKAEPTAKEMKKGMEAMMKQQPAGAAAAD* |
| Ga0137372_107603562 | 3300012350 | Vadose Zone Soil | VVDLDGYTWMVGTHKAEPTAKEMKKGMEKMMKQQQPSAAAAD* |
| Ga0137386_106183132 | 3300012351 | Vadose Zone Soil | WMVGTHKAEPTLQEMKKKMTEQMGQQPAGAATAA* |
| Ga0137384_105113131 | 3300012357 | Vadose Zone Soil | WMVGTHKAEPTLQEMKKKMKEQMGQRPAGAATAA* |
| Ga0137385_107378291 | 3300012359 | Vadose Zone Soil | PEGYAWMVGTHKAEPTLQEMKKKMTEQMGQQPAGAATAA* |
| Ga0137361_106622112 | 3300012362 | Vadose Zone Soil | WMVGTHKAEPTTKEMKAKMLEQMRPQPAGAATAA* |
| Ga0137361_109895411 | 3300012362 | Vadose Zone Soil | GYSWMVGTHKAEPTVKEMNAKMKEQMRPKPTAAAAD* |
| Ga0137396_109492352 | 3300012918 | Vadose Zone Soil | GTIVDTDGYSWMVGTHKAEPTAKEMKAKMLEQMRPQPAGTATAA* |
| Ga0137404_105103083 | 3300012929 | Vadose Zone Soil | RCGMVVDPDGYGWMVGTHKAEPTTQAMKKKMTEQMGQQPADAATVAA* |
| Ga0137410_103629531 | 3300012944 | Vadose Zone Soil | DGYTWMVGTHKAEPTVQEMKKGMEAMMKQQPPRSAAAD* |
| Ga0126369_123623632 | 3300012971 | Tropical Forest Soil | CDRIGTLVDPEGYTSMGGTYKAEASAKEMKKAMEMMKQQPVGAAAAD* |
| Ga0126369_136805612 | 3300012971 | Tropical Forest Soil | DPDGYSWMIGTHKAEPSAKEMKKGMEEMMKQMPAATAAAD* |
| Ga0157374_126524571 | 3300013296 | Miscanthus Rhizosphere | YGWMVGTHKAEPTAKEMKKKMAEQVGQQPAGTATVAA* |
| Ga0163162_106859743 | 3300013306 | Switchgrass Rhizosphere | RSLRHVVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMGQQSAGAATVAA* |
| Ga0120109_10346901 | 3300014052 | Permafrost | PEGYAWMVGTHKAEPTLQEMKKKMKEQTGQQPAGAATAA* |
| Ga0163163_110235622 | 3300014325 | Switchgrass Rhizosphere | DRDGYSWMVGTHKAEPSAKEMKKGMEEMMRQSRPEGAAAAD* |
| Ga0182041_121583022 | 3300016294 | Soil | VDPDGYSWMVGTHKAEPSAKEMKKGMEEMMKQKPAPTAAAD |
| Ga0182032_112716731 | 3300016357 | Soil | TVVDPDGYSWMIGTHKAEPSAKDMKKGMEEMMKQQPPATAAAD |
| Ga0182037_101717292 | 3300016404 | Soil | PDGYSWLVGTHKAEPSAKEMKKGMEEMMKQKPTATAAAD |
| Ga0187819_104971351 | 3300017943 | Freshwater Sediment | PDGYTWMVGTHKAEPTAKEMKKGMEEMMKQQPSGAAAAD |
| Ga0187778_109693601 | 3300017961 | Tropical Peatland | PDGYSWTIGTHKAEPTAKEMKQKMLEMMKQPPSEAAAAD |
| Ga0187783_102430141 | 3300017970 | Tropical Peatland | LDPDGYAWMVGTHKAEPTAKEMKKGMEEMMKQQPAGAAAAD |
| Ga0182025_10427061 | 3300019786 | Permafrost | PGGYAWMVGTHKAEPTLREMKKKMTEQMGQQPAGAATAA |
| Ga0210407_101591071 | 3300020579 | Soil | WKGSTQEAEPTSQEMKKKMAEQTGQQPAAATTVAA |
| Ga0210391_108152162 | 3300021433 | Soil | PDGYSWMVATHQAEPSVKEMKKKMLEQMKPPGTGTAAAD |
| Ga0126371_113759692 | 3300021560 | Tropical Forest Soil | DGYAWMVGTHKAEPTAKEMKKGMEEMMKQQPAGAAAAD |
| Ga0242662_103411371 | 3300022533 | Soil | VDPDGYIWMVGTHKAEPTAKEMQKMMMEQTPPQAA |
| Ga0242665_103914051 | 3300022724 | Soil | VVDPDGYAWMVGTHKAEPTANEMKKGMEEMMKHPPTGAAAAD |
| Ga0207699_113720661 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DPDGYGWMVGTHKAEPTTQEMKRKMAEQVAQQPADATTVAA |
| Ga0207654_101587171 | 3300025911 | Corn Rhizosphere | LDRDGYSWMVGTHKAEPSAKEMKKGMEEMMRQSRPEGAAAAD |
| Ga0207687_102464821 | 3300025927 | Miscanthus Rhizosphere | FWCDRCGVVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMGQQSAGAATVAA |
| Ga0207687_110476471 | 3300025927 | Miscanthus Rhizosphere | LRHVVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMGQQSAGAATVA |
| Ga0207640_106120562 | 3300025981 | Corn Rhizosphere | PDGYAWMVGTHKAEPTAREMNKKMAEQMEQQSTGTPTAA |
| Ga0207703_107149601 | 3300026035 | Switchgrass Rhizosphere | LRHVVDPDGYGWMVGTHKAEPTTQKMKRKMAEQMDS |
| Ga0207675_1007964342 | 3300026118 | Switchgrass Rhizosphere | TVLDRDGYSWMVGTHKAEPSAKEMKKGMEEMMRQSRPEGAAAAD |
| Ga0209807_11049021 | 3300026530 | Soil | TDGYAWMVGTHKAEPTTKEMKAKMLEQMRPQPAGAATAA |
| Ga0179587_102285351 | 3300026557 | Vadose Zone Soil | GDRCGMVVDPDGYGWMVGTHKAEPTTQEMKRKMAEQVGQQPAGAATVAA |
| Ga0207758_10069911 | 3300026895 | Tropical Forest Soil | DPDGYSWMVGTHKAEPSTKEMKKGMEEMMKQKPAATAAAD |
| Ga0208324_11267371 | 3300027604 | Peatlands Soil | PDGYSWMVGTHKVEPTAKEMKKGMLEMMRQQQTDTATATAA |
| Ga0208565_10068814 | 3300027662 | Peatlands Soil | MVGTHKVEPTAKEMKKGMLEMMRQQQTDTATATAA |
| Ga0209167_103566332 | 3300027867 | Surface Soil | DPDGYTSMVGTHKAEPSAKEMKQKMAEMTKQQPAGAAAAD |
| Ga0209488_110585922 | 3300027903 | Vadose Zone Soil | DRCGMVVDPDGYGWMVGTHKAEPTTQEMKRKMAEQVGQQPAGAATVAA |
| Ga0209583_106950761 | 3300027910 | Watersheds | DGYAWMVGTHKAEPTTQEMKKKMAEQMRQQPAATAPAA |
| Ga0209698_100953614 | 3300027911 | Watersheds | YNWMVGTHKAEPTTREMKKKMQEQMAQQPNRPATEAA |
| Ga0209168_100399346 | 3300027986 | Surface Soil | DPDGYTWMVGTHKAEPSAKEMKQKMAEMTKQQPAGAAAAD |
| Ga0265354_10271061 | 3300028016 | Rhizosphere | DRCGTIVDPDGYAWMIGTHKAEPTMKEMKRKMMEQVRLMQQQSTGAATAA |
| Ga0209526_101724251 | 3300028047 | Forest Soil | RCGMVVDPDGYGWMVGTHKAEPSTREMKKKMAEQVGQQPAGAATEAA |
| Ga0265770_10175512 | 3300030878 | Soil | TIVDPDGYAWMIGTHKAEPTMKEMKRKMMEQVRLMQQPSTGAATAA |
| Ga0318561_108496862 | 3300031679 | Soil | GYNWMVGTHKAEPSAKEMKKGMEEMMKQKPTATAASD |
| Ga0307476_103652631 | 3300031715 | Hardwood Forest Soil | IDPDGYSWMVGTHKAEPTAKEMKKGMLEMMRQQPAGTATAA |
| Ga0307477_106323351 | 3300031753 | Hardwood Forest Soil | DPDGYPWMVGTHKAEPTAKEMKKGMLEMMRQQPTDTATAA |
| Ga0307475_107596612 | 3300031754 | Hardwood Forest Soil | SWMVGTHKAEPTAKEMKKGMLEMMRQQPAGTATAA |
| Ga0307473_102463151 | 3300031820 | Hardwood Forest Soil | MDTGWMVGTHKAEPTAKEMKEKMFEKVRQQPAGTASAA |
| Ga0318527_103706801 | 3300031859 | Soil | DGYTWMVATHKAEPSVKEMKKGMEEMMKQQPAGQPTAA |
| Ga0306919_101573682 | 3300031879 | Soil | DPDGYSWMIGTHKAEPSAKEMKKGMEEMMKQMPAD |
| Ga0306925_114591072 | 3300031890 | Soil | RCETVVDANGYAWMVGTHKAEPSAKEMKQKMMEQMGSRPAGTASAA |
| Ga0306921_101894281 | 3300031912 | Soil | VLDPDGYSWMVGTHKAEPSAKEMKKGMEEMMKQQPPATAAAD |
| Ga0310916_115026631 | 3300031942 | Soil | GYNWMVGTHKAEPSAKEMKKGMEEMMKQMPTPTAASD |
| Ga0318545_103122271 | 3300032042 | Soil | VDPDGYSWLVGTHKAEPSAKEMKKGMEEMMKQKPTATAAAD |
| Ga0311301_105122793 | 3300032160 | Peatlands Soil | DPDGYPWMVGTHKAEPTAKEMKKGMLEMMRQQPTGTSAAA |
| Ga0306920_1005123773 | 3300032261 | Soil | VVDPDGYSWMVGTHKAEPSAKEMKKGMEEMMKRQLPATAAAD |
| Ga0310810_102608351 | 3300033412 | Soil | YGWTVGTHKAEPTIQEMKKKMAEQIGQQPAGTATVAA |
| ⦗Top⦘ |