


| Basic Information | |
|---|---|
| Family ID | F091500 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ECIKTIYGFSDSKAREALRLLSKEQIQKLKEQTDIGGLRK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 95.33 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.617 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (19.626 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.551 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.944 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01818 | Translat_reg | 71.03 |
| PF00011 | HSP20 | 17.76 |
| PF00149 | Metallophos | 1.87 |
| PF03796 | DnaB_C | 0.93 |
| PF14393 | DUF4422 | 0.93 |
| PF13384 | HTH_23 | 0.93 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.93 |
| PF00383 | dCMP_cyt_deam_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 17.76 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.93 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.62 % |
| All Organisms | root | All Organisms | 37.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10060118 | Not Available | 1231 | Open in IMG/M |
| 3300001843|RCM34_1011676 | Not Available | 551 | Open in IMG/M |
| 3300001850|RCM37_1077459 | Not Available | 551 | Open in IMG/M |
| 3300005528|Ga0068872_10200213 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300005583|Ga0049085_10227381 | Not Available | 615 | Open in IMG/M |
| 3300005662|Ga0078894_11335107 | Not Available | 602 | Open in IMG/M |
| 3300006863|Ga0075459_1017750 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300007304|Ga0102689_1751782 | All Organisms → Viruses | 578 | Open in IMG/M |
| 3300007538|Ga0099851_1050284 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1638 | Open in IMG/M |
| 3300007542|Ga0099846_1237946 | Not Available | 634 | Open in IMG/M |
| 3300007647|Ga0102855_1133930 | Not Available | 663 | Open in IMG/M |
| 3300007708|Ga0102859_1269211 | Not Available | 513 | Open in IMG/M |
| 3300007974|Ga0105747_1147758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 758 | Open in IMG/M |
| 3300008263|Ga0114349_1116941 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1129 | Open in IMG/M |
| 3300008266|Ga0114363_1028432 | Not Available | 2384 | Open in IMG/M |
| 3300008448|Ga0114876_1116991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1029 | Open in IMG/M |
| 3300008996|Ga0102831_1275441 | Not Available | 555 | Open in IMG/M |
| 3300009026|Ga0102829_1244182 | Not Available | 589 | Open in IMG/M |
| 3300009068|Ga0114973_10078534 | All Organisms → Viruses → Predicted Viral | 1898 | Open in IMG/M |
| 3300009085|Ga0105103_10496963 | Not Available | 684 | Open in IMG/M |
| 3300009152|Ga0114980_10716910 | Not Available | 560 | Open in IMG/M |
| 3300009154|Ga0114963_10412933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 730 | Open in IMG/M |
| 3300009159|Ga0114978_10131704 | All Organisms → Viruses → Predicted Viral | 1624 | Open in IMG/M |
| 3300009159|Ga0114978_10603719 | Not Available | 634 | Open in IMG/M |
| 3300009180|Ga0114979_10788167 | All Organisms → Viruses | 534 | Open in IMG/M |
| 3300009181|Ga0114969_10421789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 760 | Open in IMG/M |
| 3300009182|Ga0114959_10485348 | Not Available | 597 | Open in IMG/M |
| 3300009183|Ga0114974_10392406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 796 | Open in IMG/M |
| 3300009184|Ga0114976_10677665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 518 | Open in IMG/M |
| 3300009185|Ga0114971_10042080 | All Organisms → Viruses → Predicted Viral | 2892 | Open in IMG/M |
| 3300009187|Ga0114972_10084734 | All Organisms → Viruses → Predicted Viral | 2107 | Open in IMG/M |
| 3300009235|Ga0103857_10091721 | Not Available | 613 | Open in IMG/M |
| 3300009243|Ga0103860_10069481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 726 | Open in IMG/M |
| 3300009247|Ga0103861_10001832 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
| 3300009252|Ga0103863_10051343 | Not Available | 579 | Open in IMG/M |
| 3300010160|Ga0114967_10280550 | Not Available | 862 | Open in IMG/M |
| 3300010334|Ga0136644_10072172 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300010370|Ga0129336_10572839 | Not Available | 604 | Open in IMG/M |
| 3300010885|Ga0133913_10128252 | Not Available | 6791 | Open in IMG/M |
| 3300011268|Ga0151620_1039841 | Not Available | 1574 | Open in IMG/M |
| 3300012013|Ga0153805_1013289 | Not Available | 1408 | Open in IMG/M |
| 3300012522|Ga0129326_1180429 | Not Available | 567 | Open in IMG/M |
| 3300013004|Ga0164293_10342106 | Not Available | 1023 | Open in IMG/M |
| 3300013004|Ga0164293_10412606 | Not Available | 907 | Open in IMG/M |
| 3300013004|Ga0164293_11044729 | Not Available | 507 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10428999 | Not Available | 770 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10104544 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 2006 | Open in IMG/M |
| 3300014962|Ga0134315_1044746 | All Organisms → Viruses | 682 | Open in IMG/M |
| 3300017722|Ga0181347_1085177 | Not Available | 916 | Open in IMG/M |
| 3300017723|Ga0181362_1117981 | Not Available | 521 | Open in IMG/M |
| 3300017766|Ga0181343_1025330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1814 | Open in IMG/M |
| 3300017774|Ga0181358_1031851 | All Organisms → Viruses → Predicted Viral | 2060 | Open in IMG/M |
| 3300017774|Ga0181358_1217768 | Not Available | 616 | Open in IMG/M |
| 3300017777|Ga0181357_1007732 | All Organisms → Viruses → Predicted Viral | 4303 | Open in IMG/M |
| 3300017777|Ga0181357_1218256 | Not Available | 674 | Open in IMG/M |
| 3300017777|Ga0181357_1312995 | All Organisms → Viruses | 530 | Open in IMG/M |
| 3300017778|Ga0181349_1226971 | Not Available | 634 | Open in IMG/M |
| 3300017780|Ga0181346_1173154 | Not Available | 794 | Open in IMG/M |
| 3300017784|Ga0181348_1056688 | All Organisms → Viruses | 1593 | Open in IMG/M |
| 3300020048|Ga0207193_1745019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 640 | Open in IMG/M |
| 3300020160|Ga0211733_11194795 | Not Available | 637 | Open in IMG/M |
| 3300020198|Ga0194120_10389311 | Not Available | 662 | Open in IMG/M |
| 3300021519|Ga0194048_10155987 | Not Available | 856 | Open in IMG/M |
| 3300021961|Ga0222714_10394213 | Not Available | 733 | Open in IMG/M |
| 3300021964|Ga0222719_10662315 | Not Available | 596 | Open in IMG/M |
| 3300022190|Ga0181354_1222739 | Not Available | 551 | Open in IMG/M |
| 3300022407|Ga0181351_1093695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1173 | Open in IMG/M |
| 3300022407|Ga0181351_1154641 | Not Available | 820 | Open in IMG/M |
| 3300023174|Ga0214921_10472580 | Not Available | 608 | Open in IMG/M |
| 3300023184|Ga0214919_10152657 | Not Available | 1829 | Open in IMG/M |
| 3300024561|Ga0255288_1153203 | Not Available | 513 | Open in IMG/M |
| 3300025445|Ga0208424_1052649 | All Organisms → Viruses | 511 | Open in IMG/M |
| 3300025655|Ga0208795_1083769 | Not Available | 879 | Open in IMG/M |
| 3300027196|Ga0208438_1057711 | Not Available | 637 | Open in IMG/M |
| 3300027608|Ga0208974_1035369 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300027631|Ga0208133_1047996 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300027659|Ga0208975_1164175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → Synechococcus virus SCAM9 → Synechococcus phage S-CAM9 | 613 | Open in IMG/M |
| 3300027734|Ga0209087_1201892 | Not Available | 762 | Open in IMG/M |
| 3300027747|Ga0209189_1045250 | All Organisms → Viruses → Predicted Viral | 2161 | Open in IMG/M |
| 3300027754|Ga0209596_1408938 | Not Available | 507 | Open in IMG/M |
| 3300027760|Ga0209598_10397646 | Not Available | 505 | Open in IMG/M |
| 3300027764|Ga0209134_10223711 | All Organisms → Viruses | 646 | Open in IMG/M |
| 3300027772|Ga0209768_10332495 | Not Available | 628 | Open in IMG/M |
| 3300027804|Ga0209358_10335586 | Not Available | 732 | Open in IMG/M |
| 3300027808|Ga0209354_10064385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1484 | Open in IMG/M |
| 3300029930|Ga0119944_1029326 | Not Available | 715 | Open in IMG/M |
| 3300029933|Ga0119945_1030111 | Not Available | 618 | Open in IMG/M |
| 3300031951|Ga0315904_10008550 | Not Available | 13520 | Open in IMG/M |
| 3300031951|Ga0315904_11000009 | Not Available | 663 | Open in IMG/M |
| 3300031963|Ga0315901_10948947 | Not Available | 607 | Open in IMG/M |
| 3300032073|Ga0315315_10888300 | Not Available | 806 | Open in IMG/M |
| 3300032092|Ga0315905_10392568 | Not Available | 1305 | Open in IMG/M |
| 3300033981|Ga0334982_0162843 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1128 | Open in IMG/M |
| 3300033994|Ga0334996_0124287 | Not Available | 1470 | Open in IMG/M |
| 3300034061|Ga0334987_0027521 | Not Available | 5014 | Open in IMG/M |
| 3300034066|Ga0335019_0199182 | Not Available | 1297 | Open in IMG/M |
| 3300034082|Ga0335020_0427748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 635 | Open in IMG/M |
| 3300034093|Ga0335012_0349107 | Not Available | 737 | Open in IMG/M |
| 3300034102|Ga0335029_0222039 | Not Available | 1239 | Open in IMG/M |
| 3300034102|Ga0335029_0449882 | All Organisms → Viruses | 762 | Open in IMG/M |
| 3300034104|Ga0335031_0153638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1590 | Open in IMG/M |
| 3300034104|Ga0335031_0346985 | Not Available | 950 | Open in IMG/M |
| 3300034105|Ga0335035_0730038 | Not Available | 504 | Open in IMG/M |
| 3300034106|Ga0335036_0075367 | Not Available | 2520 | Open in IMG/M |
| 3300034106|Ga0335036_0732625 | Not Available | 581 | Open in IMG/M |
| 3300034110|Ga0335055_0320263 | Not Available | 657 | Open in IMG/M |
| 3300034284|Ga0335013_0284939 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.74% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 3.74% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.87% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.87% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.93% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.93% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.93% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100601184 | 3300001282 | Freshwater | VKPEKSEDLACVKTYYGLSDAKAREALRLLTEEQIQELKEKTDIGGLRK* |
| RCM34_10116761 | 3300001843 | Marine Plankton | KSEKSEDIECIKSIFGFSDTKAREALRLLSKEQIQKLKEQTDTGGLRK* |
| RCM37_10774592 | 3300001850 | Marine Plankton | VCSSDLSDKKAREALRLLNDEQIQELKEKTDIGGLRK* |
| Ga0068872_102002131 | 3300005528 | Freshwater Lake | LVYGLSDSKAREALKLLSKEQIQKLKEETFTGGLRK* |
| Ga0049085_102273811 | 3300005583 | Freshwater Lentic | KAEKSEDIACVKTYFGLSDSKAREALRLLSDEQIQEIKEKTDIGGLRK* |
| Ga0078894_113351071 | 3300005662 | Freshwater Lake | EKNDDLECIKLAFSLSDSKAREALRLLSKEQIQQLKEETYKGGLGK* |
| Ga0075459_10177501 | 3300006863 | Aqueous | DIECLKILYGYSNQKALEALRLLSDEQIQELKEKTRKGGLRK* |
| Ga0102689_17517821 | 3300007304 | Freshwater Lake | EKGEDLECVKIMYGLSDAKAREAIRLLSNEQIQQLKEQTDTGGLRK* |
| Ga0099851_10502841 | 3300007538 | Aqueous | DLECIKTAYNFSLSKARDASRLLSKEQIQELKQQTQTGGLGK* |
| Ga0099846_12379462 | 3300007542 | Aqueous | EKSEDLECIKIAFNYSDSKAKDALRLLSEEQIQKLKELTQAGGLRK* |
| Ga0102855_11339301 | 3300007647 | Estuarine | RPFNKWIKAEKSEDIACIKTYFGLSDAKAREALKLLNEEQILELKEKTDIGGLRK* |
| Ga0102859_12692111 | 3300007708 | Estuarine | CIKQVFGFSDSKASEAARLLTKEQIQQLKEQTDIGGLKR* |
| Ga0105747_11477581 | 3300007974 | Estuary Water | EKSEDIECIKATYGFSDTKAREALRLLSNEQIQQLKEQTDIGGLGK* |
| Ga0114349_11169411 | 3300008263 | Freshwater, Plankton | IECIQQVYNLSSSKAREVLRLLSKEQIQFLKQKIETGGLRK* |
| Ga0114363_10284321 | 3300008266 | Freshwater, Plankton | KLVYGLSDSKARDALRLLSKEQIQKLKEQTLTGGLGK* |
| Ga0114876_11169913 | 3300008448 | Freshwater Lake | KSEKSEDIECIKATYGFSDTKAREALRLLSNEQIQQLKEQTDIGGLGK* |
| Ga0102831_12754411 | 3300008996 | Estuarine | IKTIYGFSDSKAREALRLLSKEQIQKLKEQTDIGGLRK* |
| Ga0102829_12441821 | 3300009026 | Estuarine | KWIKAEKSEDIACIKTYFGLSDAKAREALKLLNEEQILELKEKTDIGGLRK* |
| Ga0114973_100785341 | 3300009068 | Freshwater Lake | KLVYGLSDSKAREALRLLSDEQIQQLKEKTDTGG* |
| Ga0105103_104969631 | 3300009085 | Freshwater Sediment | KSEDLECIKKVFSFSDARAREALRLLSEQQIQELKQKTDIGGLGKK* |
| Ga0114980_107169101 | 3300009152 | Freshwater Lake | KSDDIECIKQTYALSDAKARDALRLLSNEQIQKLKEQTLKGGLGK* |
| Ga0114963_104129331 | 3300009154 | Freshwater Lake | KWVKSEKSEDIECVKLAYGLSDSKAIEALRLLSDEQIQLLKEKTDTGG* |
| Ga0114978_101317043 | 3300009159 | Freshwater Lake | KMVYGLSDSKAREALRLLSDEQIQQLKEKTETGG* |
| Ga0114978_106037191 | 3300009159 | Freshwater Lake | TYALSDAKARDALRLLSNEQIQKLKEQTLKGGLGK* |
| Ga0114979_107881672 | 3300009180 | Freshwater Lake | RSVKRSFAKWAKSEKDDDIAYVKMVYGLSDIKARDAMRLLTKEQIQQLKKETLTGGLGK* |
| Ga0114969_104217891 | 3300009181 | Freshwater Lake | SEKSENIECVKLAYGLSDSKAIEALRLLSDEQIQLLKEKTDTGG* |
| Ga0114959_104853482 | 3300009182 | Freshwater Lake | VKLIYGLSDSKAREALRLLSDEQIQKLKEKTNTGG* |
| Ga0114974_103924061 | 3300009183 | Freshwater Lake | KWVKSAKSEDLTCIKQVFGFSDSKASEAARLLSKEQIQQLKEQTDIGGLKR* |
| Ga0114976_106776651 | 3300009184 | Freshwater Lake | RSFVQREKSEKNNDIECIKLVYGLSDSKALDALRLLTKEQIQQLKEKTFTGGLGK* |
| Ga0114971_100420808 | 3300009185 | Freshwater Lake | IKIIFGYSNSKAREALRLLSDEQIQELKTKTDIGGK* |
| Ga0114972_100847341 | 3300009187 | Freshwater Lake | KAEKSDDIECIKAVYGFSDTKAREALRLLSDEQIQQLKKQTDIGGLGK* |
| Ga0103857_100917212 | 3300009235 | River Water | SCIKQVFGFSDNKASEVLRLLSKEQIQQLKEQTDIGGLKR* |
| Ga0103860_100694811 | 3300009243 | River Water | SAKSEDLSCIKQVFGFSDNKASEVLRLLSKEQIQQLKEQTDIGGLKR* |
| Ga0103861_100018321 | 3300009247 | River Water | VKAEKSEDIACIKEYYGLSTSKAQEALRLLSEEQLQQIKEKLER* |
| Ga0103863_100513431 | 3300009252 | River Water | AKSEDLSCIKQVFGFSDNKASEVLRLLSKEQIQQLKEQTDIGGLKR* |
| Ga0114967_102805504 | 3300010160 | Freshwater Lake | IKQTYALSDAKARDALRLLSNEQIQKLKEQTLKGGLGK* |
| Ga0136644_100721721 | 3300010334 | Freshwater Lake | EKSEDIECIKIIFGYSNSKAREALRLLSDEQIQELKTKTDIGGK* |
| Ga0129336_105728391 | 3300010370 | Freshwater To Marine Saline Gradient | DDLECIKLAYGLSNSKAREALRLLSKEQIQKIKEESQKGGLGK* |
| Ga0133913_1012825212 | 3300010885 | Freshwater Lake | YGLSDSKALDALRLLTKEQIQQLKEKTFTGGLGK* |
| Ga0151620_10398412 | 3300011268 | Freshwater | VLRLIFGYSDAKAREALRLLSDEQIQQLKEKTDTGGLRK* |
| Ga0153805_10132894 | 3300012013 | Surface Ice | DIECIKATYGFSDTKAREALRLLSNEQIQQLKEQTDIGGLGK* |
| Ga0129326_11804291 | 3300012522 | Aqueous | RDHLQSGLSLKKSEDLECIKIAFNYSDSKAKDALRLLSEEQIQKLKELTQAGGLRK* |
| Ga0164293_103421061 | 3300013004 | Freshwater | AEKNDDLECIKLAFSLSDSKAREALRLLSKEQIQQLKEDTYRGGLGK* |
| Ga0164293_104126061 | 3300013004 | Freshwater | DIACVKTYFGLSDSKAREALRLLSDEQIQELKEKTDIGGLRK* |
| Ga0164293_110447292 | 3300013004 | Freshwater | ECIKTIYGFSDSKAREALRLLSKEQIQKLKEQTDIGGLRK* |
| (restricted) Ga0172365_104289992 | 3300013127 | Sediment | MESIIEKSEDLECIKTIYGSSDTKAREAFRLLSKEQIQQLKEK |
| (restricted) Ga0172376_101045441 | 3300014720 | Freshwater | IKQVYQFSDSKAKEALRLLSKEQIQQLKEQTHTGGLVRK* |
| Ga0134315_10447461 | 3300014962 | Surface Water | KWVKSEKGEDIECVKIMYGLSDTKAREAIRLLSNDQIQQLKEKTDTGGLRK* |
| Ga0181347_10851774 | 3300017722 | Freshwater Lake | ENIECVKLAYGLSDSKAIEALRLLSDEQIQLLKEKTDTGG |
| Ga0181362_11179812 | 3300017723 | Freshwater Lake | QTYALSDAKARDALRLLSNEQIQKLKEQTLKGGLGK |
| Ga0181343_10253301 | 3300017766 | Freshwater Lake | LECIKLAYGLSDSKAREALRLLSKEQIQQIKEKTQKGGLGK |
| Ga0181358_10318511 | 3300017774 | Freshwater Lake | KNNDIECIKLVYGLSDSKALDALRLLTKEQIQQLKKETFTGGLGK |
| Ga0181358_12177681 | 3300017774 | Freshwater Lake | IECVKLVYGLSDSKAREALRLLSDEQIQQLKEKTDTGG |
| Ga0181357_10077321 | 3300017777 | Freshwater Lake | KSEDIACVKTYFGLSDSKAREALRLLSDEQIQELKEKTDIGGLRK |
| Ga0181357_12182563 | 3300017777 | Freshwater Lake | LVYGLSDSKALDALRLLTKEQIQQLKKETFTGGLGK |
| Ga0181357_13129951 | 3300017777 | Freshwater Lake | WAKSEKSEDIECIKIIFGYSNSKAREALRLLSDEQIQELKIKTDIGGK |
| Ga0181349_12269713 | 3300017778 | Freshwater Lake | YVKMVYGLSDSKARDAMRLLTKEQIQQLKKETFTGGLGK |
| Ga0181346_11731543 | 3300017780 | Freshwater Lake | IACIKTYFGLSDAKAREALKLLNEEQILELKEKTDIGGLRK |
| Ga0181348_10566884 | 3300017784 | Freshwater Lake | IECVKLVYGLSDSKAREALRLLSDEQIQQLKEKTNTGG |
| Ga0207193_17450192 | 3300020048 | Freshwater Lake Sediment | MVYGLSDSKAQDAMRLLTKEQIQQLKKETLTGGLGK |
| Ga0211733_111947951 | 3300020160 | Freshwater | ECVKLVYGLSDSKAREALRLLSDEQIQQLKEKTNTGG |
| Ga0194120_103893113 | 3300020198 | Freshwater Lake | KSEDIECIKKYFNYSDMRAREVLLLLSEDQIQQLKEKTESGGLRK |
| Ga0194048_101559874 | 3300021519 | Anoxic Zone Freshwater | IKTYYGLSDAKAIEALRLLSNEQIQELKEKTDIGGLRK |
| Ga0222714_103942133 | 3300021961 | Estuarine Water | QVYGFSDSKAREALRLLSKDQIQQLKEQTDTGGLRK |
| Ga0222719_106623152 | 3300021964 | Estuarine Water | CIKTAYNFSLSKARDASRLLSKEQIQELKQQTQTGGLGK |
| Ga0181354_12227392 | 3300022190 | Freshwater Lake | VQNDDLECIQKMYGLSKIKAREAVRLLSDEQIQKLKEQTDTGGLRK |
| Ga0181351_10936951 | 3300022407 | Freshwater Lake | IKQVFGLSDQKAREAKRLLSNEQIQQLKEQTDTGGLRK |
| Ga0181351_11546413 | 3300022407 | Freshwater Lake | VKLVYGLSDSKARDALRLLTKEQIQQLKKETFTGGLGK |
| Ga0214921_104725802 | 3300023174 | Freshwater | SEDIECIKIIFGYSNSKAREALRLLSDEQIQELKRKTDIGGK |
| Ga0214919_101526575 | 3300023184 | Freshwater | EDIECIKIIFGYSNSKAREALRLLSDEQIQELKRKTDIGGK |
| Ga0255288_11532031 | 3300024561 | Freshwater | KSENLECVKHVFGFSDSKAREALRLLSKEQIQKLQEQTQTGGLNKR |
| Ga0208424_10526491 | 3300025445 | Aqueous | DIECLKILYGYSNQKALEALRLLSDEQIQELKEKTRKGGLRK |
| Ga0208795_10837691 | 3300025655 | Aqueous | DLECIKTAYNFSLSKARDASRLLSKEQIQELKQQTQTGGLGK |
| Ga0208438_10577113 | 3300027196 | Estuarine | IFGFSNSKALEALRLLSKEQLQQLKEHTDIGGLRK |
| Ga0208974_10353691 | 3300027608 | Freshwater Lentic | DDIACIKLVYGLSDGKARDAMRLLTKEQIQQLKKETFIGGLGK |
| Ga0208133_10479961 | 3300027631 | Estuarine | KLIYNFSDSKARDARRLLSKEQIQELKEKTDTGGLRK |
| Ga0208975_11641751 | 3300027659 | Freshwater Lentic | EKSEDIECIKIIFGYSNSKAREALRLLSDEQIQELKIKTDIGGK |
| Ga0209087_12018923 | 3300027734 | Freshwater Lake | KNNDIECIKLVYGLSDSKALDALRLLTKEQIQQLKEKTFTGGLGK |
| Ga0209189_10452501 | 3300027747 | Freshwater Lake | CIKIIFGYSNSKAREALRLLSDEQIQELKTKTDIGGK |
| Ga0209596_14089382 | 3300027754 | Freshwater Lake | LECIKQIYNFSDSKARDAWRLLSKEQIQELKEKTDIGGLRK |
| Ga0209598_103976461 | 3300027760 | Freshwater Lake | SKWAKSEKSEDMSCVKTYFNLSDAKAREALRLLSDEQIRELKDKTDTGGLRK |
| Ga0209134_102237112 | 3300027764 | Freshwater Lake | ACVKIYFGYSDAKAREALRLLSDEQIQQLKEKTDPGGLRK |
| Ga0209768_103324952 | 3300027772 | Freshwater Lake | SEDIQCIKAVYGFSDTKALEALRLLTDEQIQQLKEKTGIGGLRK |
| Ga0209358_103355861 | 3300027804 | Freshwater Lake | IYGFSDSKAREALRLLSKEQIQKLKEQTDTGGLRK |
| Ga0209354_100643854 | 3300027808 | Freshwater Lake | CIKQVFGLSDQKAREARRLLSNEQIQQLKEQTDTGGLRK |
| Ga0119944_10293261 | 3300029930 | Aquatic | ECVKLVYGLSDSKARDALRLLSKEEIQKLKQETYIGGLGK |
| Ga0119945_10301113 | 3300029933 | Aquatic | CVKLVYGLSDSKARDALRLLSKEQIQKLKEQTFTGGLGK |
| Ga0315904_100085501 | 3300031951 | Freshwater | KLVYGLSDSKAREALRLLSKEQIQKLKEETLTGGLRK |
| Ga0315904_110000093 | 3300031951 | Freshwater | SVYGFSDSKAREALKLLSKEQIQQLKEQTQTGGLTKR |
| Ga0315901_109489472 | 3300031963 | Freshwater | FSCFGLSNSKAREAMRLLSKEQIQKIKEESHKGGLGK |
| Ga0315315_108883003 | 3300032073 | Seawater | IKNDDIECIKQLYNLSDSKAKDALRLLSKEQIQKIKEQTFTGGLGK |
| Ga0315905_103925681 | 3300032092 | Freshwater | KSEKDDDIACVKMVYGLSDSKARDAMRLLTKEQIQQLKKETLTGGLGK |
| Ga0334982_0162843_1003_1128 | 3300033981 | Freshwater | LECIKTIYGFSDSKAREALRLLSKEQIQKLKEQTDIGGLRK |
| Ga0334996_0124287_1325_1468 | 3300033994 | Freshwater | PEKSDDIACIKSFYGFSDAKARDALRLLTDKQIQELKEKADKGGLGK |
| Ga0334987_0027521_1_141 | 3300034061 | Freshwater | KSEDLSCIKQVFGFSDSKASEAARLLSKEQIQQLKEQTDIGGLKRW |
| Ga0335019_0199182_3_146 | 3300034066 | Freshwater | SDKSEDIQCIKAVYGFSDTKALEALRLLTDEQIQQLKEKTGSGGLRK |
| Ga0335020_0427748_11_151 | 3300034082 | Freshwater | VKSEDLSCIKQVFGFSDSKASEAARLLSKEQIQQLKEQTDIGGLKR |
| Ga0335012_0349107_2_178 | 3300034093 | Freshwater | SKKRPFNKWVKPEKSEDLACVKTYYGLSDAKAREALRLLTEEQIQELKEKTDIGGLRK |
| Ga0335029_0222039_1_141 | 3300034102 | Freshwater | VKSEKSEDIECVKLVYGLSDSKAREALRLLSDEQIQQLKEKTNTGG |
| Ga0335029_0449882_293_436 | 3300034102 | Freshwater | VKSEDLSCIKQVFGFSDSKASEAARLLSKEQIQQLKEQTDIGGLKRW |
| Ga0335031_0153638_1470_1589 | 3300034104 | Freshwater | IKTVYGFSETKAREASRLLSKEQIQQLKEQTQTGGLNKR |
| Ga0335031_0346985_810_950 | 3300034104 | Freshwater | VKSEKSEDIACVKLAYGLSDSKAREALRLLSDEQIQLLKEKTDTGG |
| Ga0335035_0730038_2_127 | 3300034105 | Freshwater | LECIKQTYNFSDSKARDARRLLSKEQIQELKEKTDTGGLRK |
| Ga0335036_0075367_2_136 | 3300034106 | Freshwater | NDDLECIKLVYGLSDSKAREALRLLSKEQIQKLKEETLTGGLRK |
| Ga0335036_0732625_1_129 | 3300034106 | Freshwater | DIECIKATYGFSDTKAREALRLLSNEQIQQLKEQTDIGGLGK |
| Ga0335055_0320263_1_108 | 3300034110 | Freshwater | IFGFSESKAREAVRLLSKEQIQKLKEQTDIGGLRK |
| Ga0335013_0284939_950_1057 | 3300034284 | Freshwater | FGFSDTKAREALRLLSKEQIQQLKEQTQTGGLTKR |
| ⦗Top⦘ |