


| Basic Information | |
|---|---|
| Family ID | F091442 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FTEFELRQIAAVRKELDQEYETSITPLARSSQPRVSSKSAP |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.832 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (15.888 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.056 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13358 | DDE_3 | 2.80 |
| PF04392 | ABC_sub_bind | 1.87 |
| PF13586 | DDE_Tnp_1_2 | 1.87 |
| PF13683 | rve_3 | 1.87 |
| PF13577 | SnoaL_4 | 1.87 |
| PF12248 | Methyltransf_FA | 0.93 |
| PF07503 | zf-HYPF | 0.93 |
| PF01555 | N6_N4_Mtase | 0.93 |
| PF00196 | GerE | 0.93 |
| PF13426 | PAS_9 | 0.93 |
| PF01734 | Patatin | 0.93 |
| PF00107 | ADH_zinc_N | 0.93 |
| PF05598 | DUF772 | 0.93 |
| PF04386 | SspB | 0.93 |
| PF14503 | YhfZ_C | 0.93 |
| PF07799 | DUF1643 | 0.93 |
| PF00027 | cNMP_binding | 0.93 |
| PF02900 | LigB | 0.93 |
| PF04773 | FecR | 0.93 |
| PF02371 | Transposase_20 | 0.93 |
| PF13547 | GTA_TIM | 0.93 |
| PF09928 | DUF2160 | 0.93 |
| PF03150 | CCP_MauG | 0.93 |
| PF14305 | ATPgrasp_TupA | 0.93 |
| PF00872 | Transposase_mut | 0.93 |
| PF00378 | ECH_1 | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF06568 | DUF1127 | 0.93 |
| PF13551 | HTH_29 | 0.93 |
| PF01497 | Peripla_BP_2 | 0.93 |
| PF00313 | CSD | 0.93 |
| PF13546 | DDE_5 | 0.93 |
| PF14535 | AMP-binding_C_2 | 0.93 |
| PF17158 | MASE4 | 0.93 |
| PF13751 | DDE_Tnp_1_6 | 0.93 |
| PF13700 | DUF4158 | 0.93 |
| PF09140 | MipZ | 0.93 |
| PF00529 | CusB_dom_1 | 0.93 |
| PF11306 | DUF3108 | 0.93 |
| PF14602 | Hexapep_2 | 0.93 |
| PF01548 | DEDD_Tnp_IS110 | 0.93 |
| PF02899 | Phage_int_SAM_1 | 0.93 |
| PF00216 | Bac_DNA_binding | 0.93 |
| PF14224 | DUF4331 | 0.93 |
| PF03466 | LysR_substrate | 0.93 |
| PF05685 | Uma2 | 0.93 |
| PF00274 | Glycolytic | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.87 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.87 |
| COG0068 | Hydrogenase maturation factor HypF (carbamoyltransferase) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.93 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.93 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.93 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.93 |
| COG2969 | Stringent starvation protein B, binds SsrA peptide | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.93 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.93 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.93 |
| COG4333 | Uncharacterized conserved protein, DUF1643 domain | Function unknown [S] | 0.93 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.93 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.93 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.93 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.93 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.83 % |
| Unclassified | root | N/A | 26.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01CPAKL | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 728 | Open in IMG/M |
| 3300000955|JGI1027J12803_102841517 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300001686|C688J18823_10818396 | Not Available | 591 | Open in IMG/M |
| 3300002568|C688J35102_120651436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini | 1297 | Open in IMG/M |
| 3300004081|Ga0063454_101841105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum | 531 | Open in IMG/M |
| 3300005441|Ga0070700_101769587 | Not Available | 532 | Open in IMG/M |
| 3300005456|Ga0070678_100448713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300005457|Ga0070662_101224042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300005457|Ga0070662_101434511 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005552|Ga0066701_10512045 | Not Available | 742 | Open in IMG/M |
| 3300005559|Ga0066700_10209037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1351 | Open in IMG/M |
| 3300005618|Ga0068864_100216994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1763 | Open in IMG/M |
| 3300005618|Ga0068864_101765431 | Not Available | 624 | Open in IMG/M |
| 3300005764|Ga0066903_102878554 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005764|Ga0066903_103556453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300005764|Ga0066903_105105628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300005764|Ga0066903_108887295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300005841|Ga0068863_101162836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa | 777 | Open in IMG/M |
| 3300006969|Ga0075419_10934652 | Not Available | 627 | Open in IMG/M |
| 3300009098|Ga0105245_11266996 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300009520|Ga0116214_1138659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. | 903 | Open in IMG/M |
| 3300009698|Ga0116216_10851470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300009789|Ga0126307_10085984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2483 | Open in IMG/M |
| 3300009789|Ga0126307_10631767 | Not Available | 864 | Open in IMG/M |
| 3300010037|Ga0126304_10892234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 604 | Open in IMG/M |
| 3300010040|Ga0126308_11110488 | Not Available | 557 | Open in IMG/M |
| 3300010041|Ga0126312_11065030 | Not Available | 593 | Open in IMG/M |
| 3300010042|Ga0126314_10183975 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300010044|Ga0126310_10001331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 9400 | Open in IMG/M |
| 3300010166|Ga0126306_10649389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. | 843 | Open in IMG/M |
| 3300010343|Ga0074044_10978883 | Not Available | 554 | Open in IMG/M |
| 3300010366|Ga0126379_10336101 | Not Available | 1534 | Open in IMG/M |
| 3300010366|Ga0126379_10599517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1187 | Open in IMG/M |
| 3300010375|Ga0105239_10831745 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300010398|Ga0126383_10523532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300010398|Ga0126383_13197541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus → unclassified Pyxidicoccus → Pyxidicoccus sp. SCPEA002 | 535 | Open in IMG/M |
| 3300012212|Ga0150985_101383113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 523 | Open in IMG/M |
| 3300012356|Ga0137371_11321596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi1 | 532 | Open in IMG/M |
| 3300012359|Ga0137385_10204530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1723 | Open in IMG/M |
| 3300012362|Ga0137361_10293904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1486 | Open in IMG/M |
| 3300012383|Ga0134033_1003373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300012986|Ga0164304_10273213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini | 1145 | Open in IMG/M |
| 3300014158|Ga0181521_10175728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1200 | Open in IMG/M |
| 3300014158|Ga0181521_10457436 | Not Available | 618 | Open in IMG/M |
| 3300014159|Ga0181530_10346457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae | 768 | Open in IMG/M |
| 3300014200|Ga0181526_10550784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300015371|Ga0132258_12783270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1219 | Open in IMG/M |
| 3300016270|Ga0182036_10285044 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 1250 | Open in IMG/M |
| 3300016294|Ga0182041_10022831 | All Organisms → cellular organisms → Bacteria | 3865 | Open in IMG/M |
| 3300016371|Ga0182034_10015444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4416 | Open in IMG/M |
| 3300017975|Ga0187782_10210809 | Not Available | 1455 | Open in IMG/M |
| 3300018038|Ga0187855_10089789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1864 | Open in IMG/M |
| 3300018432|Ga0190275_12244371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300018468|Ga0066662_10965530 | Not Available | 841 | Open in IMG/M |
| 3300018469|Ga0190270_11117527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300021404|Ga0210389_10535093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 922 | Open in IMG/M |
| 3300025899|Ga0207642_10176575 | Not Available | 1160 | Open in IMG/M |
| 3300025900|Ga0207710_10632853 | Not Available | 560 | Open in IMG/M |
| 3300025929|Ga0207664_10953373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
| 3300025931|Ga0207644_11454076 | Not Available | 576 | Open in IMG/M |
| 3300025933|Ga0207706_10108948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 2437 | Open in IMG/M |
| 3300026023|Ga0207677_11643559 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026095|Ga0207676_11728049 | Not Available | 624 | Open in IMG/M |
| 3300026118|Ga0207675_100524185 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300026142|Ga0207698_10306810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1480 | Open in IMG/M |
| 3300026142|Ga0207698_12519506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300027824|Ga0209040_10000607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 27816 | Open in IMG/M |
| 3300029999|Ga0311339_11872719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300030503|Ga0311370_10341543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1913 | Open in IMG/M |
| 3300030707|Ga0310038_10196691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella parisiensis | 965 | Open in IMG/M |
| 3300031543|Ga0318516_10857823 | Not Available | 512 | Open in IMG/M |
| 3300031573|Ga0310915_10040313 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 2972 | Open in IMG/M |
| 3300031680|Ga0318574_10627126 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031744|Ga0306918_10771390 | Not Available | 751 | Open in IMG/M |
| 3300031794|Ga0318503_10072244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1075 | Open in IMG/M |
| 3300031846|Ga0318512_10566958 | Not Available | 578 | Open in IMG/M |
| 3300031879|Ga0306919_10164733 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300031879|Ga0306919_10548930 | Not Available | 891 | Open in IMG/M |
| 3300031890|Ga0306925_10281998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1788 | Open in IMG/M |
| 3300031890|Ga0306925_11517514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300031912|Ga0306921_10162377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2615 | Open in IMG/M |
| 3300031912|Ga0306921_10453486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1494 | Open in IMG/M |
| 3300031942|Ga0310916_11128316 | Not Available | 650 | Open in IMG/M |
| 3300031945|Ga0310913_10476303 | Not Available | 886 | Open in IMG/M |
| 3300031954|Ga0306926_11957569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium isbiliense | 660 | Open in IMG/M |
| 3300032009|Ga0318563_10463423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. IK-TO18 | 685 | Open in IMG/M |
| 3300032035|Ga0310911_10368123 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032076|Ga0306924_10988517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 925 | Open in IMG/M |
| 3300032770|Ga0335085_10546681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
| 3300032892|Ga0335081_10797758 | Not Available | 1129 | Open in IMG/M |
| 3300032896|Ga0335075_10059288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5271 | Open in IMG/M |
| 3300032896|Ga0335075_10105904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3662 | Open in IMG/M |
| 3300032896|Ga0335075_10706017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 968 | Open in IMG/M |
| 3300032896|Ga0335075_10832088 | Not Available | 859 | Open in IMG/M |
| 3300032896|Ga0335075_10994009 | Not Available | 754 | Open in IMG/M |
| 3300032896|Ga0335075_11506415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 559 | Open in IMG/M |
| 3300032897|Ga0335071_10047496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 4240 | Open in IMG/M |
| 3300032897|Ga0335071_10324261 | Not Available | 1493 | Open in IMG/M |
| 3300032897|Ga0335071_12138886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00 | 502 | Open in IMG/M |
| 3300032954|Ga0335083_11343960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00 | 548 | Open in IMG/M |
| 3300032955|Ga0335076_10857498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300033134|Ga0335073_10092344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3929 | Open in IMG/M |
| 3300033134|Ga0335073_10763646 | Not Available | 1044 | Open in IMG/M |
| 3300033134|Ga0335073_10833543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
| 3300033134|Ga0335073_11545860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300033289|Ga0310914_11116463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300033805|Ga0314864_0008301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 1969 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 15.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.28% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_01417500 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | EFELRQIAAVRKDLDAEYDAKLTPRAGHPTHAFSSKSAP |
| JGI1027J12803_1028415172 | 3300000955 | Soil | LRFTEFELRQIAAIRNDLDAEYDAKVTRSGRSSQPRFSSKSVP* |
| C688J18823_108183962 | 3300001686 | Soil | LRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP* |
| C688J35102_1206514364 | 3300002568 | Soil | GLRFTEFELRQIAAVRKDLGAEYEAMITRSDRASQTRVASRSVP* |
| Ga0063454_1018411052 | 3300004081 | Soil | EFELRQIAAVRKDLDAEYEATITRSGRSSQSRVSSKTAP* |
| Ga0070700_1017695872 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | NEFELRQIAAVRKDLDAEYEATITRSDRPSQSHVSSKTAP* |
| Ga0070678_1004487131 | 3300005456 | Miscanthus Rhizosphere | PFTEFELRQLAAIREDLNREYEAAITPTARSSQPRFSSRNVL* |
| Ga0070662_1012240421 | 3300005457 | Corn Rhizosphere | RFNEFELRQIAAVRKDLDAEYESAITRSDRPSQSHVSSKTAP* |
| Ga0070662_1014345111 | 3300005457 | Corn Rhizosphere | LPFTEFELRQLAAIREDLNREYEAAITPTARSSQPRFSSRNVL* |
| Ga0066701_105120451 | 3300005552 | Soil | WRGLRFTEFELRQIAAVRKELDAEYEAKLTPSGRSSHPRFSSKSAP* |
| Ga0066700_102090371 | 3300005559 | Soil | FELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP* |
| Ga0068864_1002169941 | 3300005618 | Switchgrass Rhizosphere | RFSEFELRQIAAVRKDLDTEYDTTITRSGRSSQPRFSSKSTP* |
| Ga0068864_1017654313 | 3300005618 | Switchgrass Rhizosphere | EFELRQLAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP* |
| Ga0066903_1028785543 | 3300005764 | Tropical Forest Soil | ELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP* |
| Ga0066903_1035564531 | 3300005764 | Tropical Forest Soil | TEFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP* |
| Ga0066903_1051056282 | 3300005764 | Tropical Forest Soil | FELRQIAAVRNDLDAEYDGKVTRSGSPSQPRFSSKSAP* |
| Ga0066903_1088872952 | 3300005764 | Tropical Forest Soil | AESWRGLRFTEFELRQLDAVRKELDADYETSIARLDRSSRSRVSSKSAP* |
| Ga0068863_1011628362 | 3300005841 | Switchgrass Rhizosphere | AAERWRGLRFSEFELRQIAAVRKDLDADYGTTITHSGRSSQPRFSSKSTP* |
| Ga0075419_109346522 | 3300006969 | Populus Rhizosphere | RRFTEFELRQIAAVQKDLDAEYEATRSDRASQTNVSSSSAP* |
| Ga0105245_112669963 | 3300009098 | Miscanthus Rhizosphere | LRQLAAVRKDLDAEYEATITRSGRSSQSRVSSKTAP* |
| Ga0116214_11386593 | 3300009520 | Peatlands Soil | FTEFELRQIAAVRKELDQEYETSITPLARSSQPRVSSKSAP* |
| Ga0116216_108514701 | 3300009698 | Peatlands Soil | DRWRGLRFTEFELRQIAAVRKDLVDEYQTSITSLATSSQPRVSSKSKP* |
| Ga0126307_100859845 | 3300009789 | Serpentine Soil | RFTEFELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP* |
| Ga0126307_106317671 | 3300009789 | Serpentine Soil | LRQIAAVRKDLDTEYQATITRSDRPAHSRISSKATP* |
| Ga0126304_108922341 | 3300010037 | Serpentine Soil | RFTEFELRQIAALRRDLDAEYEAAITRPDRPSKTRVSSRSAP* |
| Ga0126308_111104882 | 3300010040 | Serpentine Soil | FELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP* |
| Ga0126312_110650303 | 3300010041 | Serpentine Soil | LRQIAAVRKDLDAEYEAAITRLDRTSQTRVSSRSAP* |
| Ga0126314_101839751 | 3300010042 | Serpentine Soil | TDFELRQIAAIQTDLDPEYEAAITRSDTSSHPRFSGKSAP* |
| Ga0126310_1000133111 | 3300010044 | Serpentine Soil | FTEFELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP* |
| Ga0126306_106493893 | 3300010166 | Serpentine Soil | EFELRQIAAVRKDLDTEYEAMITRSDRASQTRVSSRCVP* |
| Ga0074044_109788831 | 3300010343 | Bog Forest Soil | LRFTGFELPQLTALRKELDEEYQTSITSPARSSQPRFSSKSTP* |
| Ga0126379_103361013 | 3300010366 | Tropical Forest Soil | LRFTEFELRQLDAVRKELDADYETSIARLDRSSRSRVSSKSAP* |
| Ga0126379_105995171 | 3300010366 | Tropical Forest Soil | EFELRQIAAVRNDLDAEYDGKVTRSGSPSQPRFSSKSAP* |
| Ga0105239_108317452 | 3300010375 | Corn Rhizosphere | LRFSEFELRQIAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP* |
| Ga0126383_105235324 | 3300010398 | Tropical Forest Soil | AAESWRGLRFTEFELRQLDAVRKELDADYETSIARSDRSSRSRVSSKSAP* |
| Ga0126383_131975412 | 3300010398 | Tropical Forest Soil | ESWRGLRFTEFELRQLDAVRKELDADYESSIARLDRSSRPRVSSKSAP* |
| Ga0150985_1013831132 | 3300012212 | Avena Fatua Rhizosphere | FELRQIAAVRKDLDAEYEAAITRSDRTSQTRVSSRSVP* |
| Ga0137371_113215962 | 3300012356 | Vadose Zone Soil | WRGLRFTEFELRQVAAVRKELDAEYEAKLTPSGRSSHSRFSSKSAP* |
| Ga0137385_102045304 | 3300012359 | Vadose Zone Soil | TEFELRQVAAVRKELDAEYEAKLTPSGRSSHSRFSSKSAP* |
| Ga0137361_102939041 | 3300012362 | Vadose Zone Soil | EFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP* |
| Ga0134033_10033731 | 3300012383 | Grasslands Soil | SEFELRQIAAVRKDLDAEYEATITRSRRSSQPRFSSTATP* |
| Ga0164304_102732131 | 3300012986 | Soil | TEFELRQLAAIREDLNREYEAAIIPTARSSQPRFSSRNVP* |
| Ga0181521_101757282 | 3300014158 | Bog | EFELRQLAAVRKELDEEYQATITPQARSSQPRVSSKSAP* |
| Ga0181521_104574361 | 3300014158 | Bog | LRQLAAVRKELDEEYQATITPQARSSQPRVSSKSAP* |
| Ga0181530_103464572 | 3300014159 | Bog | FELRQLAAVRKELDEEYQATITPQARSSQPRVSSKSAP* |
| Ga0181526_105507842 | 3300014200 | Bog | FELRQIAAVRKELDQEYEDSITPLARSSQPRVSSKSAP* |
| Ga0132258_127832701 | 3300015371 | Arabidopsis Rhizosphere | FELRQLDAVRNELDAEYETSITRSDRTSRPRVSSKSVP* |
| Ga0182036_102850442 | 3300016270 | Soil | LRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP |
| Ga0182041_100228311 | 3300016294 | Soil | EFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP |
| Ga0182034_100154441 | 3300016371 | Soil | SWRGLRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP |
| Ga0187782_102108091 | 3300017975 | Tropical Peatland | EFELRQIAAVRKELDQEYEASITPLARSSQPRVSSKNAP |
| Ga0187855_100897893 | 3300018038 | Peatland | RFTEFELRQLAVVRKELDEEYQATITPQARSSQPRVSGKSAP |
| Ga0190275_122443711 | 3300018432 | Soil | RWRGLRFTEFELRQIAAVQKDLDTEYEATIARSDRRAQTRFSSTSQP |
| Ga0066662_109655302 | 3300018468 | Grasslands Soil | GLRFSEFELRQIAAVRKDLDTEYDTTITRSGRSSQPRFSSTSTP |
| Ga0190270_111175272 | 3300018469 | Soil | ELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP |
| Ga0210389_105350931 | 3300021404 | Soil | TEFELRQIAAVRKDLDHEYQISTTPLARSAQPRVSSKSAP |
| Ga0207642_101765752 | 3300025899 | Miscanthus Rhizosphere | NEFELRQIAAVRKDLDAEYEATITRSGRSSQSRVSSKTAP |
| Ga0207710_106328531 | 3300025900 | Switchgrass Rhizosphere | LRQIAAVRKDLDAEYESTITLSDRPSQSHVSSKTAP |
| Ga0207664_109533732 | 3300025929 | Agricultural Soil | TEFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP |
| Ga0207644_114540762 | 3300025931 | Switchgrass Rhizosphere | RFTEFELRQIAAVQKDLDAEYEATRSDRASQTRVSSRSAP |
| Ga0207706_101089481 | 3300025933 | Corn Rhizosphere | RFNEFELRQIAAVRKDLDAEYESAITRSDRPSQSHVSSKTAP |
| Ga0207677_116435592 | 3300026023 | Miscanthus Rhizosphere | GEFELRQIAAVRKDLGAEYEATITRSGQPSQPSFSSRSAP |
| Ga0207676_117280492 | 3300026095 | Switchgrass Rhizosphere | RQIAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP |
| Ga0207675_1005241851 | 3300026118 | Switchgrass Rhizosphere | AERWRGLRFSEFELRQIAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP |
| Ga0207698_103068101 | 3300026142 | Corn Rhizosphere | TEFELRQLAAIREDLNREYEAAIIPTARSSQPRFSSRNVP |
| Ga0207698_125195062 | 3300026142 | Corn Rhizosphere | FTEFELRQIAAVQKDLDAEYEATRSDRASQTRVSSRSAP |
| Ga0209040_100006071 | 3300027824 | Bog Forest Soil | RQLAALRKELDEEYEASITAPARSSQPRFSSKSVP |
| Ga0311339_118727191 | 3300029999 | Palsa | TEFELRQIAAVRKELDGEYQASVTPLARSSQPRVSSKSKP |
| Ga0311370_103415431 | 3300030503 | Palsa | TEFELRQIAAVRKELDDEYQASVTPLARSSQPRVSSKSKP |
| Ga0310038_101966912 | 3300030707 | Peatlands Soil | GLRFTEFELRQLAVLRKELDGDYEASIMSSARSSQPRFSGKIHCRS |
| Ga0318516_108578231 | 3300031543 | Soil | EFELRQIAAVRKELDDEYQTSITPLARSSQPRVSSKSAP |
| Ga0310915_100403131 | 3300031573 | Soil | GLRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP |
| Ga0318574_106271261 | 3300031680 | Soil | AYVDAVRKELDADYETSIARSDRTSRPRVSSKLAP |
| Ga0306918_107713901 | 3300031744 | Soil | ELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP |
| Ga0318503_100722442 | 3300031794 | Soil | LRFTEFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP |
| Ga0318512_105669581 | 3300031846 | Soil | TEFELRQLDVVRKDLDAEYEASITRSDRPSRPRVSSNSAP |
| Ga0306919_101647331 | 3300031879 | Soil | FELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP |
| Ga0306919_105489302 | 3300031879 | Soil | TEFELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP |
| Ga0306925_102819981 | 3300031890 | Soil | EFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP |
| Ga0306925_115175141 | 3300031890 | Soil | ESWRGLRFTEFELRQLDAVRKELDADYETSIAQSDRTSRPRVSSKLAP |
| Ga0306921_101623775 | 3300031912 | Soil | ESWRGLRFTEFELRQLDAVRKELDADYETSIAQLDRSSRPRVSSKSAP |
| Ga0306921_104534861 | 3300031912 | Soil | LRFTEFELRQIAAVRKELDDEYQTSITPLARSSQPSVSSKSAP |
| Ga0310916_111283161 | 3300031942 | Soil | LRFTEFELRQLDAVRKELDADYETSIARSDRTSRPRLSSKLAP |
| Ga0310913_104763031 | 3300031945 | Soil | EFELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP |
| Ga0306926_119575691 | 3300031954 | Soil | RQIAAVRKELDDENQTSITPLARSAQPRVSSKSKP |
| Ga0318563_104634231 | 3300032009 | Soil | FTEFELRQIAAVRQELDKEYEDSITPLARSSQPRVSSKSAP |
| Ga0310911_103681231 | 3300032035 | Soil | ESWRGLRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP |
| Ga0306924_109885171 | 3300032076 | Soil | RFTEFELRQIAAVRKELHQEYEASITPPARSSHARVSSKSRP |
| Ga0335085_105466811 | 3300032770 | Soil | TEFELRQIAAVRKELDDEYHASITPLARSAQPRVSSKSKP |
| Ga0335081_107977582 | 3300032892 | Soil | AERWRGLRFSEFELRQLTTVRKELDEEYQTAITPPARSSQPRASSKSAP |
| Ga0335075_100592881 | 3300032896 | Soil | FELRQIAAVRKELDNEYQTSISPLARSSQTRVSSKSAP |
| Ga0335075_101059047 | 3300032896 | Soil | ELRQIAAVRKELDNEYQTSISPLARSSQTRVSSKSAP |
| Ga0335075_107060172 | 3300032896 | Soil | TEFELRQISAVRKELDDEYHASITPLARSAQPRVSSKSKP |
| Ga0335075_108320881 | 3300032896 | Soil | LRQIAAVRKELDDEYHASITPLARSAQPGVSSKSAP |
| Ga0335075_109940092 | 3300032896 | Soil | TEFKLRQIAAVRKELDQEYQASVTPLARSSQPRVSSKSAP |
| Ga0335075_115064151 | 3300032896 | Soil | TEFELRQIAAVRKELDNEYQTSISPLARSSQTRVSSKSAP |
| Ga0335071_100474967 | 3300032897 | Soil | DCQPARQLAALRKEFDEEYEASIKSPARSSQPRFSSKNAP |
| Ga0335071_103242613 | 3300032897 | Soil | LRQIAAVRKELDQEYEASITPLGSSQPRVSSKSAP |
| Ga0335071_121388861 | 3300032897 | Soil | DRWRGLRFTEFEPRQIAAVRKELDQQYEASITPLARSSQPRVSSKSAP |
| Ga0335083_113439601 | 3300032954 | Soil | FTEFEPRQIAAVRKELDQQYEASITPLARSSQPRVSSKSAP |
| Ga0335076_108574981 | 3300032955 | Soil | LRFTEFELRQIAAVRKELDQEYEASATPLARSSQPRFSSKKAP |
| Ga0335073_100923441 | 3300033134 | Soil | TEFELRQLAILRKELDEEYQTSIMSPARSSQPRFSSKSTP |
| Ga0335073_107636464 | 3300033134 | Soil | TEFKLRQIAAVRKELDQEYEASVTPLARSSQPRVSSKSAP |
| Ga0335073_108335432 | 3300033134 | Soil | LRQIAAVRKELDQEYQASVTPLARSSQPRVSSKSAP |
| Ga0335073_115458601 | 3300033134 | Soil | AERWRGLRFTQFELRQIAAVRKDLDDEYQTSITPLARSAQPRLSSKSKP |
| Ga0310914_111164631 | 3300033289 | Soil | AEGWRGLRFTEFELRQLDVVRKDLDAEYEASITRSDRPSRPRISSNSAP |
| Ga0314864_0008301_2_124 | 3300033805 | Peatland | TEFELRQIAAVRKDLDQEYEASITPLARSSQPRFSSKNAP |
| ⦗Top⦘ |