


| Basic Information | |
|---|---|
| Family ID | F091432 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDLKEFRDFIIAQRLAETKEKRNNNLTAILSVANATITETTRKEN |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.11 % |
| % of genes near scaffold ends (potentially truncated) | 26.17 % |
| % of genes from short scaffolds (< 2000 bps) | 68.22 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.486 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (19.626 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.355 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 2.80 |
| PF01464 | SLT | 1.87 |
| PF08282 | Hydrolase_3 | 1.87 |
| PF00534 | Glycos_transf_1 | 0.93 |
| PF04860 | Phage_portal | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.87 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.87 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.87 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.87 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.49 % |
| All Organisms | root | All Organisms | 35.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001968|GOS2236_1040030 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1375 | Open in IMG/M |
| 3300002835|B570J40625_100000163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 101865 | Open in IMG/M |
| 3300002835|B570J40625_100161175 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2530 | Open in IMG/M |
| 3300002835|B570J40625_100805814 | Not Available | 825 | Open in IMG/M |
| 3300005525|Ga0068877_10254624 | Not Available | 1030 | Open in IMG/M |
| 3300005527|Ga0068876_10042161 | Not Available | 2809 | Open in IMG/M |
| 3300005527|Ga0068876_10132537 | Not Available | 1472 | Open in IMG/M |
| 3300005527|Ga0068876_10303162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300005758|Ga0078117_1000188 | Not Available | 1274 | Open in IMG/M |
| 3300005758|Ga0078117_1003721 | All Organisms → Viruses → Predicted Viral | 2538 | Open in IMG/M |
| 3300005758|Ga0078117_1004238 | Not Available | 15712 | Open in IMG/M |
| 3300005805|Ga0079957_1024408 | Not Available | 4130 | Open in IMG/M |
| 3300005805|Ga0079957_1043150 | All Organisms → Viruses → Predicted Viral | 2837 | Open in IMG/M |
| 3300005805|Ga0079957_1059420 | Not Available | 2282 | Open in IMG/M |
| 3300005805|Ga0079957_1072386 | Not Available | 1983 | Open in IMG/M |
| 3300005805|Ga0079957_1074830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1940 | Open in IMG/M |
| 3300005805|Ga0079957_1094828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1644 | Open in IMG/M |
| 3300006030|Ga0075470_10061172 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300007169|Ga0102976_1012699 | Not Available | 1145 | Open in IMG/M |
| 3300007171|Ga0102977_1001415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 5270 | Open in IMG/M |
| 3300007171|Ga0102977_1003878 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
| 3300007177|Ga0102978_1005790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2623 | Open in IMG/M |
| 3300007177|Ga0102978_1005814 | Not Available | 1153 | Open in IMG/M |
| 3300007177|Ga0102978_1081011 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300008107|Ga0114340_1128889 | Not Available | 966 | Open in IMG/M |
| 3300008116|Ga0114350_1007415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6643 | Open in IMG/M |
| 3300008116|Ga0114350_1022410 | Not Available | 2605 | Open in IMG/M |
| 3300008116|Ga0114350_1025460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3582 | Open in IMG/M |
| 3300008116|Ga0114350_1040913 | Not Available | 1756 | Open in IMG/M |
| 3300008116|Ga0114350_1071990 | Not Available | 1175 | Open in IMG/M |
| 3300008120|Ga0114355_1116042 | Not Available | 1019 | Open in IMG/M |
| 3300010354|Ga0129333_10118151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2444 | Open in IMG/M |
| 3300010354|Ga0129333_10237073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1649 | Open in IMG/M |
| 3300010354|Ga0129333_10661761 | Not Available | 901 | Open in IMG/M |
| 3300010354|Ga0129333_10964349 | Not Available | 718 | Open in IMG/M |
| 3300010354|Ga0129333_11171306 | Not Available | 639 | Open in IMG/M |
| 3300010354|Ga0129333_11566654 | Not Available | 538 | Open in IMG/M |
| 3300010370|Ga0129336_10037743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2911 | Open in IMG/M |
| 3300010370|Ga0129336_10063702 | Not Available | 2189 | Open in IMG/M |
| 3300011995|Ga0153800_1034992 | Not Available | 534 | Open in IMG/M |
| 3300012012|Ga0153799_1003831 | All Organisms → Viruses → Predicted Viral | 3857 | Open in IMG/M |
| 3300012013|Ga0153805_1010996 | All Organisms → Viruses → Predicted Viral | 1556 | Open in IMG/M |
| 3300012970|Ga0129338_1133059 | Not Available | 650 | Open in IMG/M |
| 3300012970|Ga0129338_1268681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300012970|Ga0129338_1504638 | Not Available | 700 | Open in IMG/M |
| 3300013087|Ga0163212_1197172 | Not Available | 630 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10311273 | Not Available | 741 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10193995 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10551929 | Not Available | 625 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10657514 | Not Available | 556 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10089238 | All Organisms → Viruses → Predicted Viral | 2383 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10463183 | Not Available | 778 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10738274 | Not Available | 578 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10019516 | Not Available | 7889 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10294195 | Not Available | 943 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10675707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10115312 | Not Available | 2470 | Open in IMG/M |
| 3300017788|Ga0169931_10134857 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2257 | Open in IMG/M |
| 3300017788|Ga0169931_10256641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
| 3300020499|Ga0208084_1000413 | Not Available | 10238 | Open in IMG/M |
| 3300020516|Ga0207935_1011759 | Not Available | 1295 | Open in IMG/M |
| 3300020570|Ga0208465_1008802 | Not Available | 1451 | Open in IMG/M |
| 3300021961|Ga0222714_10011244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 7649 | Open in IMG/M |
| 3300021961|Ga0222714_10393651 | Not Available | 733 | Open in IMG/M |
| 3300021961|Ga0222714_10399521 | Not Available | 726 | Open in IMG/M |
| 3300022200|Ga0196901_1163524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300022752|Ga0214917_10006562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12028 | Open in IMG/M |
| 3300022752|Ga0214917_10037998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3468 | Open in IMG/M |
| 3300024276|Ga0255205_1017560 | Not Available | 1192 | Open in IMG/M |
| 3300024276|Ga0255205_1041891 | Not Available | 693 | Open in IMG/M |
| 3300024280|Ga0255209_1006601 | All Organisms → Viruses → Predicted Viral | 2047 | Open in IMG/M |
| 3300024280|Ga0255209_1027678 | Not Available | 890 | Open in IMG/M |
| 3300024289|Ga0255147_1000080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 41679 | Open in IMG/M |
| 3300024289|Ga0255147_1010348 | All Organisms → Viruses → Predicted Viral | 2043 | Open in IMG/M |
| 3300024307|Ga0255221_1015610 | Not Available | 1004 | Open in IMG/M |
| 3300024351|Ga0255141_1013676 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300024481|Ga0256330_1075783 | Not Available | 712 | Open in IMG/M |
| 3300024492|Ga0255189_1041142 | Not Available | 615 | Open in IMG/M |
| 3300024502|Ga0255181_1084935 | Not Available | 507 | Open in IMG/M |
| 3300024513|Ga0255144_1012817 | Not Available | 1459 | Open in IMG/M |
| 3300024536|Ga0256338_1103189 | Not Available | 640 | Open in IMG/M |
| 3300024865|Ga0256340_1088171 | Not Available | 762 | Open in IMG/M |
| 3300025585|Ga0208546_1057969 | Not Available | 911 | Open in IMG/M |
| 3300025585|Ga0208546_1102736 | Not Available | 639 | Open in IMG/M |
| 3300025848|Ga0208005_1119488 | Not Available | 823 | Open in IMG/M |
| 3300026455|Ga0255155_1002660 | Not Available | 3355 | Open in IMG/M |
| 3300026570|Ga0255274_1167894 | Not Available | 549 | Open in IMG/M |
| 3300026573|Ga0255269_1146835 | Not Available | 633 | Open in IMG/M |
| 3300027157|Ga0255204_1007914 | All Organisms → Viruses → Predicted Viral | 2331 | Open in IMG/M |
| 3300027793|Ga0209972_10102390 | Not Available | 1435 | Open in IMG/M |
| 3300027793|Ga0209972_10118302 | Not Available | 1307 | Open in IMG/M |
| 3300027805|Ga0209229_10005489 | Not Available | 5295 | Open in IMG/M |
| 3300027806|Ga0209985_10156715 | Not Available | 1118 | Open in IMG/M |
| 3300027836|Ga0209230_10797936 | Not Available | 513 | Open in IMG/M |
| 3300028073|Ga0255180_1079562 | Not Available | 599 | Open in IMG/M |
| 3300028083|Ga0255190_1067260 | Not Available | 524 | Open in IMG/M |
| 3300028091|Ga0255184_1035256 | Not Available | 1033 | Open in IMG/M |
| 3300029930|Ga0119944_1002187 | Not Available | 3409 | Open in IMG/M |
| 3300029930|Ga0119944_1010564 | Not Available | 1385 | Open in IMG/M |
| 3300029933|Ga0119945_1002934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2468 | Open in IMG/M |
| 3300031787|Ga0315900_10804187 | Not Available | 647 | Open in IMG/M |
| 3300031951|Ga0315904_10347567 | Not Available | 1366 | Open in IMG/M |
| 3300031951|Ga0315904_10367036 | Not Available | 1318 | Open in IMG/M |
| 3300032050|Ga0315906_10937501 | Not Available | 659 | Open in IMG/M |
| 3300032116|Ga0315903_10238132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1583 | Open in IMG/M |
| 3300034073|Ga0310130_0004205 | Not Available | 5917 | Open in IMG/M |
| 3300034073|Ga0310130_0132753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 19.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.54% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.54% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.74% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 2.80% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.80% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.80% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.87% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020499 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024280 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024307 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024492 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027157 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2236_10400305 | 3300001968 | Marine | MDLKEFRDFITAQRLAEVKEKRNANLTAILSVANATIPTTERKDN* |
| B570J40625_10000016327 | 3300002835 | Freshwater | MDLKDFRDFITAQRLAEIKEKRNSNLTAILSVANATITETTRKEN* |
| B570J40625_1001611758 | 3300002835 | Freshwater | MDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNNERKEN* |
| B570J40625_1008058142 | 3300002835 | Freshwater | MDLKDFRDFITAQRLAEVKEKRNSNLTAILSVANATITETQRKEN* |
| Ga0068877_102546242 | 3300005525 | Freshwater Lake | MDLKEFRDFITAQRLAEITEKRNSNLTAILSVATATITETQRKEN* |
| Ga0068876_100421619 | 3300005527 | Freshwater Lake | MDLKDFREFIIAQRLAEVKEKRNSNLTAILSVANATITENERKEN* |
| Ga0068876_101325374 | 3300005527 | Freshwater Lake | MDLKEFRDFITAQRLAEIKEKRNANLTAILSVANATITENERKEN* |
| Ga0068876_103031622 | 3300005527 | Freshwater Lake | MDLKEFRDFIIAQRLAETKEKRQNNLSAILSVANATITETNERKTK* |
| Ga0078117_10001885 | 3300005758 | Lake Water | MDLKEFRDFINAQRLAEIKEKRNSNLTAILSVANATITETTRKEN* |
| Ga0078117_10037212 | 3300005758 | Lake Water | MDLKDFRDFINAQRLAEIKEKRNNNLTAILSVANATITETTRKEN* |
| Ga0078117_100423817 | 3300005758 | Lake Water | MDLKDFRDFINAQRLAEIKEKRNNNLTAILSVANATIQPTTTRKEN* |
| Ga0079957_102440813 | 3300005805 | Lake | MSVASTIIQLTNERKTKMDLIDFRNHVLAERLAEIKEKRNNNLTAILSVAGATISTT |
| Ga0079957_10431509 | 3300005805 | Lake | MDLKEFRDLIIAQRLAENKEKRNNNLTAILSVANATITETTRKEN* |
| Ga0079957_10594204 | 3300005805 | Lake | MDLKEFRDFIIAQRLAETKEKRNANLTAILSVANATITNTNERKTK* |
| Ga0079957_10723865 | 3300005805 | Lake | MDLIDFRNYILAERLAEIKEKRNNNLAAILSVANATIQELNERKTENE* |
| Ga0079957_10748305 | 3300005805 | Lake | MDLKEFRDFIIAQRLAETKEKRNANLTAILSVANATITETNERKTK* |
| Ga0079957_10948284 | 3300005805 | Lake | MDLKEFRDFIIAQRLAETKEKRKNNLTAILSVANATITETTGKEN* |
| Ga0075470_100611723 | 3300006030 | Aqueous | MSDPSPIIQLLNERKTKMDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNKERKEN* |
| Ga0102976_10126993 | 3300007169 | Freshwater Lake | MDLKDFRDFITAQRLAEIKEKRNNNLTAILSVANATISTTERKEN* |
| Ga0102977_10014151 | 3300007171 | Freshwater Lake | RDFINAQRLAEIKEKRNSNLTAILSVANATITETTRKEN* |
| Ga0102977_10038785 | 3300007171 | Freshwater Lake | MKLDEFKAYVIAQRLAETKEKRSKNLTAILSVANATITET |
| Ga0102978_10057905 | 3300007177 | Freshwater Lake | MDLKDFRDFINAQRLAEIKEKRNSNLSAILSVANATMSNNERKEN* |
| Ga0102978_10058144 | 3300007177 | Freshwater Lake | MDLKDFRDFINAQRLAEIKEKRNANLTAILSVANATITETTGKEN* |
| Ga0102978_10810112 | 3300007177 | Freshwater Lake | MKLDEFKAYVIAQRLAETKEKRSKNLTAILSVANATITETTRKEN* |
| Ga0114340_11288892 | 3300008107 | Freshwater, Plankton | MDLKEFRDFIIAQRLAETKEKRNNNLTAILSVANATITETTRKEN* |
| Ga0114350_100741515 | 3300008116 | Freshwater, Plankton | MDLKDFRDFITAQRLAEITEKRNSNLTAILSVATATITETQRKEN* |
| Ga0114350_10224109 | 3300008116 | Freshwater, Plankton | MDLKEFRDFITAQRLAEIKEKRNSNLTAILSVANATITETTRKEN* |
| Ga0114350_10254604 | 3300008116 | Freshwater, Plankton | MKLDEFKAYVIAQRLAETKEKRSNNLAAILSVANATITETQRKEN* |
| Ga0114350_10409135 | 3300008116 | Freshwater, Plankton | MSVASTIIQLLNERKTKMDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNNERKEN* |
| Ga0114350_10719901 | 3300008116 | Freshwater, Plankton | MDLKEFRDFITAQRLAEVKEKRNANLTAILSVANATITENERKEN* |
| Ga0114355_11160421 | 3300008120 | Freshwater, Plankton | MDLKDFRDLITAQRLAEVKEKRNANLTAILSVANATISETNEGKTK* |
| Ga0129333_101181514 | 3300010354 | Freshwater To Marine Saline Gradient | MDLKEFRDFITAQRLAEIKEKRNANLTAILSVANATITETTRKEN* |
| Ga0129333_102370735 | 3300010354 | Freshwater To Marine Saline Gradient | MDLKEFRDFITAQRLAEIKEKRNANLTAILSVANATISETTRKEN* |
| Ga0129333_106617614 | 3300010354 | Freshwater To Marine Saline Gradient | MDLIDFRNHVLAERLAEIKEKRNNNLTAILSVAGATISTTTNERKTENE* |
| Ga0129333_109643491 | 3300010354 | Freshwater To Marine Saline Gradient | NERKTKMDLKEFRDFITAQRLAEVKEKRNANLTAILSVANATIAETQRKEN* |
| Ga0129333_111713063 | 3300010354 | Freshwater To Marine Saline Gradient | MNLEEFKALVTAQRLAEITEKRNANLTAILSVANATISETNEGKTK* |
| Ga0129333_115666541 | 3300010354 | Freshwater To Marine Saline Gradient | MDLKDFRDFINAQRLAEIKEKRNSNLTAILSVANAT |
| Ga0129336_100377436 | 3300010370 | Freshwater To Marine Saline Gradient | MSVAFATIRLINERKTEMDLKDFRDFITAQRLAEIKEKRNNNLTAILSVANATISTTERKEN* |
| Ga0129336_100637022 | 3300010370 | Freshwater To Marine Saline Gradient | MDLKEFRDFITAQRLAEVKEKRNANLTAILSVANATIAETQRKEN* |
| Ga0153800_10349921 | 3300011995 | Freshwater | MDLKDFRDLIIAQRLAEIKEKRNNNLTAILSVANATITETTRKEN* |
| Ga0153799_100383110 | 3300012012 | Freshwater | MDLKDFRDLIIAQRLAENKEKRNNNLTAILSVANATITETTRKEN* |
| Ga0153805_10109966 | 3300012013 | Surface Ice | LKDFRDLIIAQRLAEIKEKRNNNLTAILSVANATITETTRKEN* |
| Ga0129338_11330591 | 3300012970 | Aqueous | EMDLKDFRDFITAQRLAEVKEKRNSNLTAILSVANATITETTRKEN* |
| Ga0129338_12686811 | 3300012970 | Aqueous | EMDLKDFRDFITAQRLAEVKEKRNSNLTAILSVANATITETQRKEN* |
| Ga0129338_15046383 | 3300012970 | Aqueous | MKLDEFKAYVIAQRLAETKEKRSNNLAAILSVANATITETTRKEN* |
| Ga0163212_11971722 | 3300013087 | Freshwater | MSHPPAIISFINERKTKVDLKEFREFIIAQRLAETKEKRNANLNAMMSVANATISETKGKEN* |
| (restricted) Ga0172368_103112732 | 3300013123 | Freshwater | MERKTKMDLKEFREFIIAQRLAETKEKRKNNLTAILSVAGATITETNERKTK* |
| (restricted) Ga0172367_101939955 | 3300013126 | Freshwater | MERKTKMDLKEFREFIIAQRLAETKEKRNNNLTAILSVANATISNNERKEN* |
| (restricted) Ga0172367_105519291 | 3300013126 | Freshwater | MDLKEFKEFIIAQRLAETKEKRKNNLTAILSVANATISNNERKEN* |
| (restricted) Ga0172367_106575142 | 3300013126 | Freshwater | MDLKEFREFIIAQRLAETKEKRKNNLTAILSVAGAT |
| (restricted) Ga0172373_100892387 | 3300013131 | Freshwater | MDLKEFREFIIAQRLAETKEKRNNNLTAILSVAGAT |
| (restricted) Ga0172373_104631832 | 3300013131 | Freshwater | MDLKEFREFIIAQRLAETKEKRKNNLTAILSVAGATIQELNERKTK* |
| (restricted) Ga0172373_107382743 | 3300013131 | Freshwater | MERKTKMDLKEFREFIIAQRLAETKEKRNNNLTAILSV |
| (restricted) Ga0172372_1001951613 | 3300013132 | Freshwater | MDLKEFREFIIAQRLAETKEKRNNNLTAILSVAGATIPTNNERKEN* |
| (restricted) Ga0172370_102941954 | 3300013136 | Freshwater | MDLKEFKEFIIAQRLAETKEKRKNNLTAILSVAGATITETNERKTK* |
| (restricted) Ga0172375_106757073 | 3300013137 | Freshwater | ERKTKMDLKEFKEFIIAQRLAETKEKRKNNLTAILSVANATISNNERKEN* |
| (restricted) Ga0172371_101153129 | 3300013138 | Freshwater | MDLKEFREFIIAQRLAETKEKRKNNLTAILSVAGATITETNERKTK* |
| Ga0169931_101348576 | 3300017788 | Freshwater | MDLKEFKEFIIAQRLAETKEKRKNNLTAILSVANATISNNERKEN |
| Ga0169931_102566413 | 3300017788 | Freshwater | MDLKEFREFIIAQRLAETKEKRNNNLTAILSVANATISNNERKEN |
| Ga0208084_100041321 | 3300020499 | Freshwater | MDLKDFRDFITAQRLAEIKEKRNSNLTAILSVANATITETTRKEN |
| Ga0207935_10117595 | 3300020516 | Freshwater | MKLDEFKAYVIAQRLAETKEKRSNNLAAILSVANATITETQRKEN |
| Ga0208465_10088023 | 3300020570 | Freshwater | MDLKEFRDFITAQRLAEVKEKRNANLTAILSVANATIAETQRKEN |
| Ga0222714_1001124416 | 3300021961 | Estuarine Water | MDLKEFRDFIIAQRLAETKEKRNANLTAILSVANATITNTNERKTK |
| Ga0222714_103936515 | 3300021961 | Estuarine Water | RKEFRDFIIAQRLAETKEKRNANLTAILSVANATIANTNERKTK |
| Ga0222714_103995212 | 3300021961 | Estuarine Water | MKLDEFKAYVIAQRLAETKEKRSKNLSAILSVANATITETERKEN |
| Ga0196901_11635241 | 3300022200 | Aqueous | DLKEFRDLIIAQRLAENKEKRNNNLIAILSVANATITKTTRKEN |
| Ga0214917_100065627 | 3300022752 | Freshwater | MDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNKERKEN |
| Ga0214917_100379985 | 3300022752 | Freshwater | MDLIEFRNLINAQRLAEIKEKRNNNLTAILSVANATISDNNERKEN |
| Ga0255205_10175604 | 3300024276 | Freshwater | MKLDEFKAYVIAQRLAETKEKRSKNLSAILSVANATITNTNERKTK |
| Ga0255205_10418912 | 3300024276 | Freshwater | MDLKEFRDFIIAQRLAETKEKRQNNLSAILSVANATITETNERKTK |
| Ga0255209_10066015 | 3300024280 | Freshwater | MKLDEFKAYVIAQRLAETKEKRSKNLSAILSVANATITNTNER |
| Ga0255209_10276784 | 3300024280 | Freshwater | NSTSMKLDEFKAYVIAQRLAETKEKRSKNLSAILSVANATITETERKEN |
| Ga0255147_10000804 | 3300024289 | Freshwater | MDLKEFRDFINAQRLAEIKEKRNNNLTAILSVANATITETTRKEN |
| Ga0255147_10103481 | 3300024289 | Freshwater | MDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNNERKEN |
| Ga0255221_10156104 | 3300024307 | Freshwater | MKLDEFKAYVIAQRLAETKEKRSKNLSAILSVANATITETNERKTK |
| Ga0255141_10136761 | 3300024351 | Freshwater | LIEFRNLINAQRLAEIKEKRNNNLTAILSVANATISDNNERKEN |
| Ga0256330_10757831 | 3300024481 | Freshwater | MDLKEFRDFINAQRLAEIKEKRNSNLTAILSVANATITETTRKEN |
| Ga0255189_10411422 | 3300024492 | Freshwater | MDLKDFRDLINAQRLAEIKEKRNNNLTAILSVANATITETTRKEN |
| Ga0255181_10849351 | 3300024502 | Freshwater | MDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATITETTRKEN |
| Ga0255144_10128171 | 3300024513 | Freshwater | MDLIEFRNLINAQRLAEIKEKRNNNLTAILSVANAT |
| Ga0256338_11031894 | 3300024536 | Freshwater | MDLKEFREFIIAQRLAEVKEKRNSNLSAILSVANATITETTRKAN |
| Ga0256340_10881711 | 3300024865 | Freshwater | KTKMDLKEFREFIIAQRLAEVKEKRNSNLSAILSVANATITETTRKEN |
| Ga0208546_10579691 | 3300025585 | Aqueous | MDLIEFRNHILAERMAEIKEKRNNNLTAILSVANAT |
| Ga0208546_11027364 | 3300025585 | Aqueous | IQLLNERKTKMDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNKERKEN |
| Ga0208005_11194883 | 3300025848 | Aqueous | MDLKDFRDFITAQRLAEVKEKRNSNLTAILSVANATISDNNERKEN |
| Ga0255155_10026609 | 3300026455 | Freshwater | MDLKEFREFIIAQRLAEVKEKRNSNLSAILSVANATITETTRKEN |
| Ga0255274_11678943 | 3300026570 | Freshwater | MDLIEFRNHILAERMAEIKEKRNNNLTAILSVANATISDNN |
| Ga0255269_11468354 | 3300026573 | Freshwater | KMDLKEFREFIIAQRLAEVKEKRNSNLSAILSVANATITETTRKEN |
| Ga0255204_10079141 | 3300027157 | Freshwater | MKLDEFKAYVIAQRLAETKEKRSKNLSAILSVANATITNTNERKT |
| Ga0209972_101023905 | 3300027793 | Freshwater Lake | MDLKEFRDFITAQRLAEITEKRNSNLTAILSVATATITETQRKEN |
| Ga0209972_101183022 | 3300027793 | Freshwater Lake | MDLKDFREFIIAQRLAEVKEKRNSNLTAILSVANATITENERKEN |
| Ga0209229_100054898 | 3300027805 | Freshwater And Sediment | MDLKDFRDFITAQRLAEITEKRNSNLTAILSVATATITETQRKEN |
| Ga0209985_101567151 | 3300027806 | Freshwater Lake | MDLKDFREFIIAQRLAEVKEKRNSNLTAILSVANAT |
| Ga0209230_107979362 | 3300027836 | Freshwater And Sediment | MDLKDFRDLIIAQRLAENKEKRNNNLTAILSVANATITETTRKEN |
| Ga0255180_10795621 | 3300028073 | Freshwater | FRNLINAQRLAEIKEKRNNNLTAILSVANATISDNNERKEN |
| Ga0255190_10672602 | 3300028083 | Freshwater | MDLKEFRDFIIAQRLAETKEKRQNNLSAILSVANA |
| Ga0255184_10352561 | 3300028091 | Freshwater | MDLKEFREFIIAQRLAEVKEKRNSNLSAILSVANATITETT |
| Ga0119944_10021876 | 3300029930 | Aquatic | MDLKEFRDFIIAQRLAENKEKRNANLTAILSVANATITNTNERKTK |
| Ga0119944_10105642 | 3300029930 | Aquatic | MDLKEFRDFITAQRLAEIKEKRNSNLAAILSVANATITETERKEN |
| Ga0119945_10029341 | 3300029933 | Aquatic | MDLKEFRDFITAQRLAEIKEKRNANLTAILSVANATISTNNERKEN |
| Ga0315900_108041871 | 3300031787 | Freshwater | MDLKDFRDFITAQRLAEIKEKRNANLTAILSVANATITETERKEN |
| Ga0315904_103475676 | 3300031951 | Freshwater | MDLKEFRDFITAQRLAEIKEKRNSNLTAILSVANATITETTRKEN |
| Ga0315904_103670361 | 3300031951 | Freshwater | MDLKDFRDLITAQRLAEVKEKRNANLTAILSVANATISETNEGKTK |
| Ga0315906_109375013 | 3300032050 | Freshwater | MDLKDFRDFITAQRLAEVKEKRNSNLTAILSVANATITETTRKEN |
| Ga0315903_102381323 | 3300032116 | Freshwater | MDLKDFRDFITAQRLAEITEKRNSNLTAILSVANATITETTRKEN |
| Ga0310130_0004205_4835_4972 | 3300034073 | Fracking Water | MDLKEFRDLIIAQRLAENKEKRNNNLTAILSVANATITETTRKEN |
| Ga0310130_0132753_592_732 | 3300034073 | Fracking Water | MDLKEFRDFIIAQRLAETKEKRNANLTAILSVANATITETNERKTK |
| ⦗Top⦘ |