


| Basic Information | |
|---|---|
| Family ID | F091393 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MTEEITAEEIARHYSAAMDSVNLLNAGQPEGMSDED |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 97.12 % |
| % of genes near scaffold ends (potentially truncated) | 94.39 % |
| % of genes from short scaffolds (< 2000 bps) | 89.72 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (37.383 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (32.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.682 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.963 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.69% β-sheet: 0.00% Coil/Unstructured: 70.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 70.09 |
| PF16778 | Phage_tail_APC | 1.87 |
| PF07460 | NUMOD3 | 1.87 |
| PF13392 | HNH_3 | 1.87 |
| PF01075 | Glyco_transf_9 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.96 % |
| Unclassified | root | N/A | 28.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100794927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
| 3300004095|Ga0007829_10112919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300005582|Ga0049080_10160977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300006107|Ga0007836_1122938 | Not Available | 557 | Open in IMG/M |
| 3300006120|Ga0007867_1142151 | Not Available | 516 | Open in IMG/M |
| 3300006121|Ga0007824_1097190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300007344|Ga0070745_1283841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300007344|Ga0070745_1284469 | Not Available | 592 | Open in IMG/M |
| 3300007346|Ga0070753_1156488 | Not Available | 861 | Open in IMG/M |
| 3300007516|Ga0105050_10878000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300007538|Ga0099851_1125604 | Not Available | 967 | Open in IMG/M |
| 3300007538|Ga0099851_1225539 | All Organisms → Viruses | 676 | Open in IMG/M |
| 3300007538|Ga0099851_1349864 | All Organisms → Viruses | 516 | Open in IMG/M |
| 3300007631|Ga0102939_1070061 | Not Available | 1059 | Open in IMG/M |
| 3300007960|Ga0099850_1081122 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300008266|Ga0114363_1060321 | All Organisms → Viruses → Predicted Viral | 2575 | Open in IMG/M |
| 3300008450|Ga0114880_1171671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1 | 758 | Open in IMG/M |
| 3300009155|Ga0114968_10232004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
| 3300009159|Ga0114978_10406267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300009159|Ga0114978_10476623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300009163|Ga0114970_10493936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300009184|Ga0114976_10161068 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300010293|Ga0116204_1073457 | Not Available | 1225 | Open in IMG/M |
| 3300010334|Ga0136644_10580952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300010370|Ga0129336_10757684 | Not Available | 512 | Open in IMG/M |
| 3300010885|Ga0133913_11266414 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300012017|Ga0153801_1018179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1253 | Open in IMG/M |
| 3300012779|Ga0138284_1110227 | Not Available | 510 | Open in IMG/M |
| 3300013286|Ga0136641_1042917 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300013295|Ga0170791_16244332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 1230 | Open in IMG/M |
| 3300013372|Ga0177922_10008876 | Not Available | 923 | Open in IMG/M |
| 3300014050|Ga0119952_1026686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
| 3300017701|Ga0181364_1050908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300017716|Ga0181350_1060077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 993 | Open in IMG/M |
| 3300017716|Ga0181350_1133609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300017722|Ga0181347_1067061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
| 3300017722|Ga0181347_1159833 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 611 | Open in IMG/M |
| 3300017723|Ga0181362_1104172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300017736|Ga0181365_1024172 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
| 3300017747|Ga0181352_1137525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Qadamvirus → Qadamvirus SB28 | 653 | Open in IMG/M |
| 3300017761|Ga0181356_1081893 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300017761|Ga0181356_1194307 | All Organisms → Viruses | 604 | Open in IMG/M |
| 3300017774|Ga0181358_1045034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1684 | Open in IMG/M |
| 3300017774|Ga0181358_1200484 | Not Available | 653 | Open in IMG/M |
| 3300017777|Ga0181357_1032691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2051 | Open in IMG/M |
| 3300017777|Ga0181357_1270098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300017777|Ga0181357_1277049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300017778|Ga0181349_1046719 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300017778|Ga0181349_1078783 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300017778|Ga0181349_1221318 | All Organisms → Viruses | 645 | Open in IMG/M |
| 3300017784|Ga0181348_1029684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2303 | Open in IMG/M |
| 3300017784|Ga0181348_1077731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
| 3300017784|Ga0181348_1080506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1293 | Open in IMG/M |
| 3300017784|Ga0181348_1278378 | Not Available | 568 | Open in IMG/M |
| 3300017785|Ga0181355_1205759 | Not Available | 771 | Open in IMG/M |
| 3300017785|Ga0181355_1359453 | Not Available | 534 | Open in IMG/M |
| 3300017949|Ga0181584_10596627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 669 | Open in IMG/M |
| 3300017951|Ga0181577_10262241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pedosvirus → Pedosvirus S28C3 | 1133 | Open in IMG/M |
| 3300017967|Ga0181590_10780490 | Not Available | 637 | Open in IMG/M |
| 3300019784|Ga0181359_1104508 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300019784|Ga0181359_1153585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300019784|Ga0181359_1206347 | All Organisms → Viruses | 629 | Open in IMG/M |
| 3300020716|Ga0214207_1037192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300021962|Ga0222713_10506120 | Not Available | 721 | Open in IMG/M |
| 3300022190|Ga0181354_1024019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1956 | Open in IMG/M |
| 3300022190|Ga0181354_1092522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300022190|Ga0181354_1134951 | Not Available | 783 | Open in IMG/M |
| 3300022200|Ga0196901_1018129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2867 | Open in IMG/M |
| 3300022822|Ga0222646_103741 | All Organisms → Viruses → Predicted Viral | 2822 | Open in IMG/M |
| 3300022851|Ga0222691_1029184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 820 | Open in IMG/M |
| 3300022929|Ga0255752_10393131 | Not Available | 549 | Open in IMG/M |
| 3300023240|Ga0222676_1008938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 1970 | Open in IMG/M |
| 3300025115|Ga0209835_1022278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1992 | Open in IMG/M |
| 3300025353|Ga0208255_104457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
| 3300025382|Ga0208256_1001724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4303 | Open in IMG/M |
| 3300025645|Ga0208643_1161556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage Venkman EXVC282S | 558 | Open in IMG/M |
| 3300025646|Ga0208161_1021007 | Not Available | 2459 | Open in IMG/M |
| 3300025781|Ga0208386_1010479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
| 3300025889|Ga0208644_1057286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2119 | Open in IMG/M |
| 3300027144|Ga0255102_1023408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300027733|Ga0209297_1335881 | Not Available | 552 | Open in IMG/M |
| 3300027749|Ga0209084_1062353 | Not Available | 1747 | Open in IMG/M |
| 3300027759|Ga0209296_1199720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027763|Ga0209088_10280084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300027772|Ga0209768_10255125 | Not Available | 758 | Open in IMG/M |
| 3300027772|Ga0209768_10344233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300027782|Ga0209500_10207167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300027782|Ga0209500_10313673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300027785|Ga0209246_10138041 | Not Available | 958 | Open in IMG/M |
| 3300027798|Ga0209353_10058774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1 | 1761 | Open in IMG/M |
| 3300027896|Ga0209777_10292316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1263 | Open in IMG/M |
| 3300027963|Ga0209400_1080153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
| 3300027983|Ga0209284_10346523 | Not Available | 742 | Open in IMG/M |
| 3300031519|Ga0307488_10319526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 992 | Open in IMG/M |
| 3300031539|Ga0307380_11272356 | Not Available | 564 | Open in IMG/M |
| 3300031787|Ga0315900_10843843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1 | 625 | Open in IMG/M |
| 3300031787|Ga0315900_10943502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 574 | Open in IMG/M |
| 3300031787|Ga0315900_11049523 | Not Available | 530 | Open in IMG/M |
| 3300031951|Ga0315904_10749285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1 | 812 | Open in IMG/M |
| 3300031952|Ga0315294_10449551 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300032177|Ga0315276_12559510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300032462|Ga0335396_10158643 | All Organisms → Viruses → Predicted Viral | 1491 | Open in IMG/M |
| 3300032462|Ga0335396_10598370 | Not Available | 687 | Open in IMG/M |
| 3300034106|Ga0335036_0784613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 32.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 3.74% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.74% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.87% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.87% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.87% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.93% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007631 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023240 | Saline water microbial communities from Ace Lake, Antarctica - #870 | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1007949272 | 3300002835 | Freshwater | MNTITPEQQIAKHYSAALDSVALINAGQPEGMSNEDWADTLKR |
| Ga0007829_101129191 | 3300004095 | Freshwater | MTDIIDTPTAEEIAKHYSAAMDSVNLINGTKPENETDAEW |
| Ga0049080_101609772 | 3300005582 | Freshwater Lentic | MNEITAEQIAKHYSACMDSVNLINAGKPEKMEDAEWA |
| Ga0007836_11229382 | 3300006107 | Freshwater | MTDIIEQPTSEEIAKHYSAAMDSVNLINGTKPENETD |
| Ga0007867_11421512 | 3300006120 | Freshwater | MTDIVETLTAEEIAKHYSAAMDSVNLINGTKPENETDAEWTATLQ |
| Ga0007824_10971902 | 3300006121 | Freshwater | MTDIVEQPTAEEIARHYSAAMDSVNLINGNKLANETDTEWTATLQRNK |
| Ga0070745_12838411 | 3300007344 | Aqueous | MDYTAEEIAQYYSAAMDSVNLLNAGKAADMSNDDW |
| Ga0070745_12844692 | 3300007344 | Aqueous | MTDTIEITAEDIAKHYSAAMDSVNLINGSKPTGMSD |
| Ga0070753_11564882 | 3300007346 | Aqueous | MEDQITAEQIAKHYSAAMDSVNLLNAGQPEGMSDE |
| Ga0105050_108780002 | 3300007516 | Freshwater | MNDTIEITAEEIARHYSATMDSVNLINAGQPEGTTDED |
| Ga0099851_11256041 | 3300007538 | Aqueous | MNEEITAEEIARHYSAAMDSVNLINAGQPEGMLDDEW |
| Ga0099851_12255392 | 3300007538 | Aqueous | MENEITAEEIARHYQAALDSVNLINAGQPEGMDDDEW |
| Ga0099851_13498642 | 3300007538 | Aqueous | MEDLTPEQIAQHYSAAMDSVALLNAGQPEGMDDAD* |
| Ga0102939_10700613 | 3300007631 | Pond Water | MSEKKTAEEIAQYYNAAMDSVNLINKGQQEDMSDE |
| Ga0099850_10811221 | 3300007960 | Aqueous | MEDNKPTAEQIAQHYSAAMDSVNLLNAGKPEGMSDED |
| Ga0114363_10603214 | 3300008266 | Freshwater, Plankton | MTELVQEITAEEIARHLSAAMDSVNLINGDKPEDMEDADW |
| Ga0114880_11716712 | 3300008450 | Freshwater Lake | MTDIITAEEIARHLSAALDSVALINNGQPEDMADD |
| Ga0114968_102320041 | 3300009155 | Freshwater Lake | MTIETQTPTAEEIARHYSAAMDSVNLINAGQPEGMS |
| Ga0114978_104062671 | 3300009159 | Freshwater Lake | MNDIITAEEISQHYKAAMDSVNLINGDKPENTTDEEWEAT |
| Ga0114978_104766232 | 3300009159 | Freshwater Lake | MEIEITAEQIAKHYSAAMDSVNLINGTKPEMMTDVDWADC |
| Ga0114970_104939362 | 3300009163 | Freshwater Lake | MTETITAEQIAQHYKAAMDSVNLINAGKPEDMTAEDW |
| Ga0114970_107773341 | 3300009163 | Freshwater Lake | MNELTEAQQIAQHYSSAMDSVNLINAGKPTDWIGTDAD |
| Ga0114969_103022262 | 3300009181 | Freshwater Lake | LKEIEMIELTESQQIAQHYKAAMDSVNLINAGQPED |
| Ga0114976_101610681 | 3300009184 | Freshwater Lake | MSETIEKPTAEEIAQHYSAAMDSVNLINAGKPEGM |
| Ga0116204_10734573 | 3300010293 | Anoxic Lake Water | MNDTLTPEEIQRHYSAALDSCNLINAGQPEGMDDEEW |
| Ga0136644_105809522 | 3300010334 | Freshwater Lake | MSETTITPEEIAQHYKAAMDSVNLINAGKPEGMTA |
| Ga0129336_107576841 | 3300010370 | Freshwater To Marine Saline Gradient | MTMEDNKPTAEEIARHYSAAMDSVNLLNAGKPESMSDED |
| Ga0133913_112664143 | 3300010885 | Freshwater Lake | MTTETQTPEQIARHYSAAMDSVNLINAGQPEGMTDAD |
| Ga0153801_10181791 | 3300012017 | Freshwater | MNMDIEITAEQIAKHYSAAMDSVNLINGSKPELMSDA |
| Ga0138284_11102271 | 3300012779 | Freshwater Lake | MDIDQLTPEQIAQHYAASLDSVNLINAGQPESMSDDDW |
| Ga0136641_10429171 | 3300013286 | Freshwater | MSETIEQPTAEQIAKHYSACMDSVHLIEAGKPEGMTAEDW |
| Ga0170791_162443322 | 3300013295 | Freshwater | MTIETQTPKQIARHYSAAMDSVNLINAGQPEKMSDE |
| Ga0177922_100088763 | 3300013372 | Freshwater | MIEAATPTAEEIARHYSAAMDSVNLINAGQPEGME |
| Ga0119952_10266863 | 3300014050 | Freshwater | MDTQTPEQIARHYSAAMDSVNLINGGTPEHQRDKDWGG |
| Ga0181364_10509082 | 3300017701 | Freshwater Lake | MTDTLTAEQIAKHYSAAMDSVALINAGKPEDMLDADWA |
| Ga0181350_10600772 | 3300017716 | Freshwater Lake | VTTETITAQQIAQHYSACMDSVNLINAGQPEDMTAED |
| Ga0181350_11336091 | 3300017716 | Freshwater Lake | MEIENTAEQIAKHYSAAMDSVNLINGGKPEMMSDADWA |
| Ga0181347_10670611 | 3300017722 | Freshwater Lake | MSETTITPTEIAQHYSAAMDSVNLINAGQPEGMTAES |
| Ga0181347_11598332 | 3300017722 | Freshwater Lake | MSETTITPTEIAQHYSACMDSVNLINAGQPEGMTAEDWAD |
| Ga0181362_11041721 | 3300017723 | Freshwater Lake | MNEITAEQIAKNYSAAMDSVNLINGGQPEDMTDAD |
| Ga0181365_10241723 | 3300017736 | Freshwater Lake | MITETLTPEQIAKHYSAAMDSVNLINGDKPERMSAEDWAD |
| Ga0181352_11375252 | 3300017747 | Freshwater Lake | MEDNKPTAEEIARHYSAAMDSVNLLNAGKPEDMKNE |
| Ga0181356_10818931 | 3300017761 | Freshwater Lake | MSETTITPTEIAQHYSAAMDSVNLINAGQPEGMTAED |
| Ga0181356_11943072 | 3300017761 | Freshwater Lake | MENKITAEQIAKHYSAAMDSVALINGSQPEYMSDADW |
| Ga0181358_10450342 | 3300017774 | Freshwater Lake | MTETLTPEQIAKHYSAAMDSVNLINDGKPEMMTDAEWA |
| Ga0181358_12004842 | 3300017774 | Freshwater Lake | MSETTITPEQIAKHYSAAMDSVALINAGKPEGMTD |
| Ga0181357_10326912 | 3300017777 | Freshwater Lake | MTIETQTPEQIAKHYSAAMDSVNLINAGKPATMTDA |
| Ga0181357_12700981 | 3300017777 | Freshwater Lake | MENQTPEQIAQHYSAAMDSVNLINGGKPEHMTDAE |
| Ga0181357_12770492 | 3300017777 | Freshwater Lake | MNIEQPSAEQIAQHYSAAMDSVNLINAGKPERMSDE |
| Ga0181349_10467191 | 3300017778 | Freshwater Lake | MEELTQAQIAKHYSAAMDSVNLINAGQPEGMTAEDW |
| Ga0181349_10787832 | 3300017778 | Freshwater Lake | MTDTQTPAQIAQHYKDVMDSVNLIDGGNPEYMSDADW |
| Ga0181349_12213182 | 3300017778 | Freshwater Lake | MIDTQTAEQIAKHYSAAMDSVNLINGGKPANMTDADWA |
| Ga0181348_10296841 | 3300017784 | Freshwater Lake | MTIETQTPEQIAKHYSAAMDSVNLINAGKPATMTDAEWA |
| Ga0181348_10777311 | 3300017784 | Freshwater Lake | MTTETQTPEQIAKHYSACMDSVNLINGGKPEGMEADEWT |
| Ga0181348_10805062 | 3300017784 | Freshwater Lake | MEIEITAEQIAKHYSAAMDSVALINGSQPEYMSDA |
| Ga0181348_12783782 | 3300017784 | Freshwater Lake | MTIETQTPTPEQIAKHYSAAMDSVALINAGKPEDMLDADWA |
| Ga0181355_11288611 | 3300017785 | Freshwater Lake | MEIEITAEQIAKHYSAAMDSVALINGGKPEMMSDED |
| Ga0181355_12057591 | 3300017785 | Freshwater Lake | MNEITAEQIAQHLSAAMDSVNLINAGKPEGMEDADW |
| Ga0181355_13594531 | 3300017785 | Freshwater Lake | MTTETPEQIAQHYSACMDSVNLINAGKPEGMSDADWTAC |
| Ga0181584_105966271 | 3300017949 | Salt Marsh | MTEELTAEEIQARYDAAMDSVNLLNNGKPEDMDDD |
| Ga0181577_102622411 | 3300017951 | Salt Marsh | MDDLTPEQIAKHYSAAMDSVDLLNAGQPEGMDADDW |
| Ga0181590_107804901 | 3300017967 | Salt Marsh | MEEQTPEQIAKHYSAAMDSVNLLNAGKPAEMSDED |
| Ga0181359_11045081 | 3300019784 | Freshwater Lake | MTTETPEQIAQHYSAAMDSVNLINAGKPEGMTDADWTAC |
| Ga0181359_11535853 | 3300019784 | Freshwater Lake | MSETTITPTEIAQHYSAAMDSVNLINAGQPEGMTAEDWAD |
| Ga0181359_12063471 | 3300019784 | Freshwater Lake | MIDTQTPEQIAKHYSAAMDSVNLINAGKPATMSDAEW |
| Ga0214207_10371922 | 3300020716 | Freshwater | MTDIIETPTADEIAKHYSAAMDSVNLINGTKPTNISDAEWTDTL |
| Ga0222713_105061201 | 3300021962 | Estuarine Water | MFNNEIEEITAEDIAQHYSAAMDSVNLINAGKPENMDDAEWVVCLQSN |
| Ga0181354_10240192 | 3300022190 | Freshwater Lake | MIELTLEQQIAKHYSAAMDSVNLINGTKPELMTDAE |
| Ga0181354_10925222 | 3300022190 | Freshwater Lake | MTTETQTPEQIAKHYSAAMDSVNLINGNKPEGMTDAEWA |
| Ga0181354_11349512 | 3300022190 | Freshwater Lake | MNEITAEQIAQHLSAAMDSVNLINAGKPEGMEDAD |
| Ga0196901_10181291 | 3300022200 | Aqueous | MDDLTPEQIAQHYSAAMDSVDLLNAGQPEGMDDAE |
| Ga0222646_1037411 | 3300022822 | Saline Water | MNDTIETTPEQIAKHYSSAMDSVNLINAGQPEGTTDEDW |
| Ga0222691_10291841 | 3300022851 | Saline Water | MENLQTIETPTPEEIQRHFNAAMDSVNLINAGQPEGMT |
| Ga0255752_103931312 | 3300022929 | Salt Marsh | MEIEITSEQIAKHYSAAMDSVALINGGKPEMMSDE |
| Ga0222676_10089383 | 3300023240 | Saline Water | MENLQTIETPTPEEIQRHFNAAMDSVNLINAGQPEGITDED |
| Ga0209835_10222783 | 3300025115 | Anoxic Lake Water | MNDTLTPEEIQRHYSAALDSCNLINAGQPEGMDDEE |
| Ga0208255_1044571 | 3300025353 | Freshwater | MTDIIDQPTAEEIAKHYSAAMDSVNLINGTKPENETDAE |
| Ga0208256_10017241 | 3300025382 | Freshwater | MRDIVETPTADEIARHYSAAMDSVNLINGTKPTNISDAEWTD |
| Ga0208643_11615561 | 3300025645 | Aqueous | MLEITPEEIAQQYSAMQDSVALIAAGKPEFMLDEE |
| Ga0208161_10210072 | 3300025646 | Aqueous | MTEEITAEEIARHYSAAMDSVNLLNAGQPEGMSDED |
| Ga0208386_10104791 | 3300025781 | Freshwater | MTDIIEQPTSEEIAKHYSAAMDSVNLINGTKPENETDSE |
| Ga0208644_10572861 | 3300025889 | Aqueous | MTDIIETPTAEEIARHYSAAMDSVALINAGQPEGMTD |
| Ga0255102_10234081 | 3300027144 | Freshwater | MDEILTPEQVAGHYSAAMDSVDLINAGKPESMDDAQWV |
| Ga0209297_13358812 | 3300027733 | Freshwater Lake | MEEITQAQIAQHYKAAMDSVNLINAGQPEDMTAEDWA |
| Ga0209084_10623532 | 3300027749 | Freshwater Lake | MSEIIEQITAEEIARHYSAAMDSVALINAGQPEGMEDAE |
| Ga0209296_11997201 | 3300027759 | Freshwater Lake | MDEILTPEQVAGHYSAAMDSVDLINAGKPESMDDAQ |
| Ga0209088_102800841 | 3300027763 | Freshwater Lake | MENIETVTPEQVARHYSAALDSVALINAGQPELMSDEDWA |
| Ga0209768_102551251 | 3300027772 | Freshwater Lake | MTIETQTPTAEEIAKHYSAAMDSVNLINGTKPEFTSDADW |
| Ga0209768_103442332 | 3300027772 | Freshwater Lake | MEQITTEQIAKHYSAAMDSVNIINGTKPELMTDVEWADC |
| Ga0209500_102071672 | 3300027782 | Freshwater Lake | MENIVEQPTAEQIAKHYSAAMDSVNLITAGQPEGMSD |
| Ga0209500_103136731 | 3300027782 | Freshwater Lake | MNDIITAEEISQHYKAAMDSVNLINGDKPENTTDEEWE |
| Ga0209246_101380412 | 3300027785 | Freshwater Lake | MTETLTPEQIAKHYSAAINSVNLINAGKPEGMTAEDWAD |
| Ga0209353_100587741 | 3300027798 | Freshwater Lake | MEIEITAEQIAKHYSAAMDSVNLINGGQPEGMTAE |
| Ga0209777_102923162 | 3300027896 | Freshwater Lake Sediment | MTDIIETPTADEIARHYSAAMDSVNLINGAKFASMT |
| Ga0209400_10801533 | 3300027963 | Freshwater Lake | MENVETVTPEQVAKHYSAALDSVALIEAGQPEGMEDA |
| Ga0209284_103465233 | 3300027983 | Freshwater | MNDTIEITAEEIARHYSAAMDSVNLINAGQPEGTTDED |
| Ga0307488_103195262 | 3300031519 | Sackhole Brine | VDYTTEEIAQYYSAAMDSVDLLNAGKPVETSDDDW |
| Ga0307380_112723561 | 3300031539 | Soil | MENEITAEQIAQHYKAMGDSVNLINAGQPDDMSDE |
| Ga0315900_108438432 | 3300031787 | Freshwater | MNEITAKQIAQHLSAAMDSVNLINAGQPEGMTDEDWAD |
| Ga0315900_109435022 | 3300031787 | Freshwater | MNDITAEQIAQHYSACMDSVNLINAGQPEKMTDEDW |
| Ga0315900_110495231 | 3300031787 | Freshwater | MEDNKPTAEEIARHYSAAMDSVNLLNAGKPEGMKDED |
| Ga0315904_107492851 | 3300031951 | Freshwater | MNEITAKQIAQHLSAAMDSVNLINAGQPEGMTDEDWADFL |
| Ga0315294_104495511 | 3300031952 | Sediment | MSDETVTPEQIAKNYSASLDSVNLINAGRPVELTLEE |
| Ga0315276_125595102 | 3300032177 | Sediment | METIDQLTQEQIAQHYSAAMDSVNLINGGQPEGMSDND |
| Ga0335396_101586431 | 3300032462 | Freshwater | MNDTIEITAEEIARHYSAAMDSVNLINAGQPEGTTDE |
| Ga0335396_105983701 | 3300032462 | Freshwater | MTDTIEITAEEIARHYSATMDSVNLINAGQPEGMTDE |
| Ga0335036_0784613_448_552 | 3300034106 | Freshwater | MIDTQTPAQIAKHYSAAMDSVNLINGGKPEQMSDA |
| ⦗Top⦘ |