


| Basic Information | |
|---|---|
| Family ID | F091247 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LVPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.64 % |
| % of genes near scaffold ends (potentially truncated) | 47.66 % |
| % of genes from short scaffolds (< 2000 bps) | 84.11 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.617 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (14.953 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (37.383 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 23.36 |
| PF00044 | Gp_dh_N | 2.80 |
| PF11146 | DUF2905 | 1.87 |
| PF00162 | PGK | 1.87 |
| PF02374 | ArsA_ATPase | 1.87 |
| PF02800 | Gp_dh_C | 1.87 |
| PF07719 | TPR_2 | 1.87 |
| PF13671 | AAA_33 | 0.93 |
| PF02915 | Rubrerythrin | 0.93 |
| PF05593 | RHS_repeat | 0.93 |
| PF00701 | DHDPS | 0.93 |
| PF13181 | TPR_8 | 0.93 |
| PF01797 | Y1_Tnp | 0.93 |
| PF00696 | AA_kinase | 0.93 |
| PF13722 | CstA_5TM | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 4.67 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 1.87 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.93 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.62 % |
| Unclassified | root | N/A | 37.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003858|Ga0031656_10164740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 771 | Open in IMG/M |
| 3300003859|Ga0031653_10002595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4822 | Open in IMG/M |
| 3300009053|Ga0105095_10066266 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300009053|Ga0105095_10405308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 753 | Open in IMG/M |
| 3300009053|Ga0105095_10580692 | Not Available | 623 | Open in IMG/M |
| 3300009053|Ga0105095_10692191 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009078|Ga0105106_10764905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 689 | Open in IMG/M |
| 3300009078|Ga0105106_10983232 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009111|Ga0115026_10797623 | Not Available | 738 | Open in IMG/M |
| 3300009153|Ga0105094_10280254 | Not Available | 959 | Open in IMG/M |
| 3300009153|Ga0105094_10514450 | Not Available | 696 | Open in IMG/M |
| 3300009167|Ga0113563_13826103 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009171|Ga0105101_10017873 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
| 3300009503|Ga0123519_10017680 | All Organisms → cellular organisms → Bacteria | 9783 | Open in IMG/M |
| 3300010413|Ga0136851_10050279 | All Organisms → cellular organisms → Bacteria | 4549 | Open in IMG/M |
| 3300012931|Ga0153915_10013651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei | 7840 | Open in IMG/M |
| 3300012931|Ga0153915_10269306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans | 1893 | Open in IMG/M |
| 3300012931|Ga0153915_10642298 | Not Available | 1223 | Open in IMG/M |
| 3300012931|Ga0153915_10869120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 1047 | Open in IMG/M |
| 3300012931|Ga0153915_10884856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 1038 | Open in IMG/M |
| 3300012931|Ga0153915_11169881 | Not Available | 898 | Open in IMG/M |
| 3300012931|Ga0153915_11615420 | Not Available | 758 | Open in IMG/M |
| 3300012931|Ga0153915_12054117 | Not Available | 669 | Open in IMG/M |
| 3300012931|Ga0153915_13446931 | Not Available | 512 | Open in IMG/M |
| 3300012964|Ga0153916_10044714 | All Organisms → cellular organisms → Bacteria | 3957 | Open in IMG/M |
| 3300012964|Ga0153916_10195103 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300012964|Ga0153916_10417543 | Not Available | 1403 | Open in IMG/M |
| 3300012964|Ga0153916_10578121 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300012964|Ga0153916_11874111 | Not Available | 671 | Open in IMG/M |
| 3300012964|Ga0153916_12782404 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012964|Ga0153916_13000183 | Not Available | 531 | Open in IMG/M |
| 3300013078|Ga0153914_1174660 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014656|Ga0180007_10457189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 771 | Open in IMG/M |
| 3300017939|Ga0187775_10052066 | Not Available | 1253 | Open in IMG/M |
| 3300017944|Ga0187786_10471435 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300017966|Ga0187776_10172476 | Not Available | 1344 | Open in IMG/M |
| 3300017966|Ga0187776_10742150 | Not Available | 699 | Open in IMG/M |
| 3300017972|Ga0187781_10482655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 889 | Open in IMG/M |
| 3300018018|Ga0187886_1270483 | Not Available | 638 | Open in IMG/M |
| 3300018029|Ga0187787_10474199 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018032|Ga0187788_10183878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 803 | Open in IMG/M |
| 3300018032|Ga0187788_10444725 | Not Available | 552 | Open in IMG/M |
| 3300018062|Ga0187784_11570528 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018064|Ga0187773_10825631 | Not Available | 591 | Open in IMG/M |
| 3300018089|Ga0187774_10431543 | Not Available | 811 | Open in IMG/M |
| 3300018089|Ga0187774_10522404 | Not Available | 752 | Open in IMG/M |
| 3300018090|Ga0187770_10924547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 700 | Open in IMG/M |
| 3300020074|Ga0194113_10827494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10 | 631 | Open in IMG/M |
| 3300020222|Ga0194125_10361956 | Not Available | 932 | Open in IMG/M |
| 3300022551|Ga0212089_10044786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2622 | Open in IMG/M |
| 3300022593|Ga0236338_1078568 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3 | 700 | Open in IMG/M |
| (restricted) 3300024341|Ga0233421_10030372 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300027713|Ga0209286_1347264 | Not Available | 510 | Open in IMG/M |
| 3300027723|Ga0209703_1200076 | Not Available | 735 | Open in IMG/M |
| 3300027726|Ga0209285_10109177 | Not Available | 847 | Open in IMG/M |
| 3300027731|Ga0209592_1269338 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027740|Ga0214474_1039457 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300027811|Ga0256868_10008460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 5053 | Open in IMG/M |
| 3300027811|Ga0256868_10137482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 1069 | Open in IMG/M |
| 3300027885|Ga0209450_10138817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 1666 | Open in IMG/M |
| 3300027885|Ga0209450_10498511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 891 | Open in IMG/M |
| 3300027885|Ga0209450_10513793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 877 | Open in IMG/M |
| 3300027900|Ga0209253_10010032 | All Organisms → cellular organisms → Bacteria | 8133 | Open in IMG/M |
| 3300027900|Ga0209253_10892571 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300027955|Ga0209078_1147471 | Not Available | 655 | Open in IMG/M |
| 3300031746|Ga0315293_10936967 | Not Available | 622 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1314679 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031949|Ga0214473_10006909 | All Organisms → cellular organisms → Bacteria | 13518 | Open in IMG/M |
| 3300031949|Ga0214473_10537518 | Not Available | 1299 | Open in IMG/M |
| 3300031949|Ga0214473_10588050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1230 | Open in IMG/M |
| 3300031999|Ga0315274_10060506 | All Organisms → cellular organisms → Bacteria | 5055 | Open in IMG/M |
| 3300031999|Ga0315274_10243703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2190 | Open in IMG/M |
| 3300032053|Ga0315284_10765330 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1123 | Open in IMG/M |
| 3300032069|Ga0315282_10059116 | All Organisms → cellular organisms → Bacteria | 3981 | Open in IMG/M |
| 3300032069|Ga0315282_10382955 | Not Available | 858 | Open in IMG/M |
| 3300032118|Ga0315277_10707879 | Not Available | 968 | Open in IMG/M |
| 3300032156|Ga0315295_10251191 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300032163|Ga0315281_10744155 | Not Available | 1017 | Open in IMG/M |
| 3300032163|Ga0315281_10895547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 908 | Open in IMG/M |
| 3300032163|Ga0315281_11227434 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300032401|Ga0315275_11683095 | Not Available | 676 | Open in IMG/M |
| 3300032829|Ga0335070_10066565 | All Organisms → cellular organisms → Bacteria | 3886 | Open in IMG/M |
| 3300032892|Ga0335081_10103395 | All Organisms → cellular organisms → Bacteria | 4226 | Open in IMG/M |
| 3300033004|Ga0335084_10267616 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300033413|Ga0316603_10304537 | Not Available | 1409 | Open in IMG/M |
| 3300033413|Ga0316603_10851812 | Not Available | 858 | Open in IMG/M |
| 3300033413|Ga0316603_12140930 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300033419|Ga0316601_100994855 | Not Available | 837 | Open in IMG/M |
| 3300033433|Ga0326726_10201352 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300033433|Ga0326726_10301029 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300033480|Ga0316620_10192442 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300033480|Ga0316620_10454286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1173 | Open in IMG/M |
| 3300033480|Ga0316620_10639787 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300033480|Ga0316620_10664875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 986 | Open in IMG/M |
| 3300033480|Ga0316620_11406391 | Not Available | 688 | Open in IMG/M |
| 3300033481|Ga0316600_10466280 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 | 873 | Open in IMG/M |
| 3300033486|Ga0316624_10357399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 1206 | Open in IMG/M |
| 3300033486|Ga0316624_11070270 | Not Available | 729 | Open in IMG/M |
| 3300033487|Ga0316630_10330149 | Not Available | 1188 | Open in IMG/M |
| 3300033489|Ga0299912_10063177 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
| 3300033489|Ga0299912_10409655 | Not Available | 1110 | Open in IMG/M |
| 3300033804|Ga0314863_029360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1113 | Open in IMG/M |
| 3300033977|Ga0314861_0089496 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300034083|Ga0373901_103033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 599 | Open in IMG/M |
| 3300034090|Ga0326723_0586787 | Not Available | 515 | Open in IMG/M |
| 3300034165|Ga0364942_0264929 | Not Available | 562 | Open in IMG/M |
| 3300034894|Ga0373916_0005168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1400 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 14.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 13.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.15% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 12.15% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 5.61% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.87% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.87% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.93% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.93% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009503 | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014656 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
| 3300024341 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_107_MG | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034083 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.2 | Engineered | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0031656_101647401 | 3300003858 | Freshwater Lake Sediment | VEQLVEEQPPQEELAVLLNFPPLEKAKADIIRLTLLLLHSGQMIF* |
| Ga0031653_100025952 | 3300003859 | Freshwater Lake Sediment | LELQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH* |
| Ga0105095_100662663 | 3300009053 | Freshwater Sediment | VDEQVPQDELAVFLNFPPTEKAKEDIMRLTFLLLH* |
| Ga0105095_104053082 | 3300009053 | Freshwater Sediment | YLEPQVEQLVAAQPPQEELAVLLNFPPTEKAKADIIR* |
| Ga0105095_105806921 | 3300009053 | Freshwater Sediment | LEPQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPLHL |
| Ga0105095_106921912 | 3300009053 | Freshwater Sediment | VLQVEQLVAEQPPQEELAVLLNFPPLEKAKADITR* |
| Ga0105106_107649051 | 3300009078 | Freshwater Sediment | IRQYYLPQVEQVVAAQPPQEELAALLNFPPLEKAKADIIR* |
| Ga0105106_109832322 | 3300009078 | Freshwater Sediment | VLQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIRWTFLL* |
| Ga0115026_107976232 | 3300009111 | Wetland | LLQPEQLLDEQEQHEELAVLLNFPPTQKAKADMTRVTFLLLHSG |
| Ga0105094_102802542 | 3300009153 | Freshwater Sediment | VDEQVPQDELAVLLNFPPTEKAKEDIMRLTFLLLH* |
| Ga0105094_105144502 | 3300009153 | Freshwater Sediment | LEPQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPL |
| Ga0113563_138261032 | 3300009167 | Freshwater Wetlands | SYLLHDEQLLAEQPPQDELAVLLNFPPLEKAKADIIRSTFLLLH* |
| Ga0105101_100178731 | 3300009171 | Freshwater Sediment | LLQPEQLLEEQEPHEELAVLLNFPPTEKAKADMTRVT |
| Ga0123519_1001768015 | 3300009503 | Hot Spring | LAPFPFYFELQEEQEVAEQLLQEELAVLLNFPPLEK |
| Ga0136851_100502796 | 3300010413 | Mangrove Sediment | VPQVEQLVAAQPPQEEVPVLLNFPPLEKAKADIIRWTFLLLH* |
| Ga0153915_100136512 | 3300012931 | Freshwater Wetlands | LELQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIR* |
| Ga0153915_102693063 | 3300012931 | Freshwater Wetlands | YYLEQVEQLVAAQPPQEELAVLLNFPPTEKAKADIIR* |
| Ga0153915_106422982 | 3300012931 | Freshwater Wetlands | LEPQVVQLVAEQPPQEELAVLLNFPPLEKAKADIIR* |
| Ga0153915_108691201 | 3300012931 | Freshwater Wetlands | VEQLVDEQVPQEELAVLLNFPPTEKANEDIIRLTFLLLH* |
| Ga0153915_108848562 | 3300012931 | Freshwater Wetlands | RTLRYFPQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIR* |
| Ga0153915_111698811 | 3300012931 | Freshwater Wetlands | LEPQVEQLLEEQVPQEELAVLLNLPPLEKANADIIR* |
| Ga0153915_116154201 | 3300012931 | Freshwater Wetlands | LELQVEQLVEAQPLQEEFAVLLNFLPMENAKADIIRVTFLLLH* |
| Ga0153915_120541171 | 3300012931 | Freshwater Wetlands | LEPQVEQVVAAQPLQEELAVLLNFPPLEKAKADIIL* |
| Ga0153915_134469312 | 3300012931 | Freshwater Wetlands | LDPQVEQLGAEQVPQEELAVLLNFPPLEKANADIMRL |
| Ga0153916_100447142 | 3300012964 | Freshwater Wetlands | VPQVEQLAAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH* |
| Ga0153916_101951033 | 3300012964 | Freshwater Wetlands | LDPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIVR* |
| Ga0153916_104175431 | 3300012964 | Freshwater Wetlands | VEQLVAAQPPQDELAVLLNFPPLENAKADIIRPTFLLLH |
| Ga0153916_105781212 | 3300012964 | Freshwater Wetlands | LEPQVEQVVAEHVPQEEPAVLLNFPPTDKAKADITR* |
| Ga0153916_118741112 | 3300012964 | Freshwater Wetlands | LEQVEQLLDEQVPQEELAVLLNLPPLEKAKADIIR* |
| Ga0153916_127824042 | 3300012964 | Freshwater Wetlands | VPQVEQLLEEQVPQEEPAVLLNFPPTEKAKADIIR* |
| Ga0153916_130001831 | 3300012964 | Freshwater Wetlands | LEPQVEQLDEEQLPQEELVVLLNFPLTEKAKADMMRRTFLLLHF |
| Ga0153914_11746601 | 3300013078 | Freshwater Wetlands | LNPTTLYLEPQVEQVVAAQPLQEELVVLLNFPPLEKAKADIIL* |
| Ga0180007_104571891 | 3300014656 | Groundwater | PPQEELAVLLNFPPLEKAKADIIRLTLLLLHSGQMIF* |
| Ga0187775_100520661 | 3300017939 | Tropical Peatland | VEQLVEEQPLQEELAVLLNFPLLEKAKADIIRWTF |
| Ga0187786_104714351 | 3300017944 | Tropical Peatland | VPQVEQLVAAQPVQEELAVLLNFPPTEKAKADIIL |
| Ga0187776_101724762 | 3300017966 | Tropical Peatland | LEPQVEQLVAAHPLQEELAVLLNFPPLEKAKADIVR |
| Ga0187776_107421501 | 3300017966 | Tropical Peatland | LDPQDEQLVAEHPPQDELAVLLNFPPLEKAKADIIRSTFLLLH |
| Ga0187781_104826551 | 3300017972 | Tropical Peatland | LEPQVEQEVAEQVPQEELAVLLNFPPTEKAKADITR |
| Ga0187886_12704832 | 3300018018 | Peatland | LELQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR |
| Ga0187787_104741991 | 3300018029 | Tropical Peatland | LEPQVEQLVAAQPLQEELVVLLNFPPLEKAKADIMR |
| Ga0187788_101838782 | 3300018032 | Tropical Peatland | VDTYLEQVEQLVAAQPPQEELAVLLNFPPTEKAKADMIR |
| Ga0187788_104447252 | 3300018032 | Tropical Peatland | VEQLVAAQLPQEEPAVLLNFPPTEKAKADITRWTFLLLHFGQAIFS |
| Ga0187784_115705281 | 3300018062 | Tropical Peatland | LIYFEPQVEQVVAEQVPQEEPAVLLNFPPTERAKADITR |
| Ga0187773_108256312 | 3300018064 | Tropical Peatland | LEPQVEQLVAAQPLHEELAVLLNFPLLEKAKADIIRWTFLLL |
| Ga0187774_104315432 | 3300018089 | Tropical Peatland | MRLHYLPQVEQLVAAQPVQEELAVLLNFPPTEKAKADIIRWTFLLLH |
| Ga0187774_105224041 | 3300018089 | Tropical Peatland | LEPQVEQLLGEEQLPQEELAVLLNFPPTEKAKADMTRRTFLLLH |
| Ga0187770_109245471 | 3300018090 | Tropical Peatland | LEPQVEQEVAEHVPQEELAVLLNFPPTEKAKADITR |
| Ga0194113_108274942 | 3300020074 | Freshwater Lake | VEQLLEEQPPQEELAVLLNFPPLEKAKADIIRPTFL |
| Ga0194125_103619562 | 3300020222 | Freshwater Lake | LWQVEQLLEEQPLQEELAVLLNFPPLEKAKADIIRLT |
| Ga0212089_100447861 | 3300022551 | Lake Sediment | LEQVEQLVAEQVPQEELAVLLNLPPLEKAKADIIR |
| Ga0236338_10785681 | 3300022593 | Freshwater | LPQPEQFPEEQLPQDELAVLLNFPPLEKAKADIFRLTFLALHLGQPIFSE |
| (restricted) Ga0233421_100303721 | 3300024341 | Freshwater | VEQLEEEQPLQEELAVLLNFPPLEKAKADIIRLTFLLLHS |
| Ga0209286_13472641 | 3300027713 | Freshwater Sediment | VEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLP |
| Ga0209703_12000762 | 3300027723 | Freshwater Sediment | VEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPLHLG |
| Ga0209285_101091772 | 3300027726 | Freshwater Sediment | VKIYLLQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPL |
| Ga0209592_12693381 | 3300027731 | Freshwater Sediment | RYLEPQVEQLVAAQPPQEELAVLLNFPPTEKAKADIIR |
| Ga0214474_10394572 | 3300027740 | Soil | LNPRTLYLEPQVEQVVAAQPLQEELAVLLNFPPLEKAKADIIL |
| Ga0256868_100084604 | 3300027811 | Soil | VKFVKSHLPQVEQLLDEQVPQEELAVLLNFPPLEKAKADIIRLTFLLLH |
| Ga0256868_101374821 | 3300027811 | Soil | ILRTDYLEPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR |
| Ga0209450_101388172 | 3300027885 | Freshwater Lake Sediment | LELQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH |
| Ga0209450_104985112 | 3300027885 | Freshwater Lake Sediment | QVEQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH |
| Ga0209450_105137931 | 3300027885 | Freshwater Lake Sediment | EQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTLLLLH |
| Ga0209253_100100321 | 3300027900 | Freshwater Lake Sediment | EPQVEQLVEEQPPQEELAVLLNFPPLEKAKADIIRLTLLLLHSGQIIF |
| Ga0209253_108925711 | 3300027900 | Freshwater Lake Sediment | LEQVEQLLDEQVPQEELAALLNLLPLEKAKADIIR |
| Ga0209078_11474711 | 3300027955 | Freshwater Sediment | VKIYLLQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLP |
| Ga0315293_109369672 | 3300031746 | Sediment | VEQLVEEQPLQEELAVLLNFPPLEKAKEDIIRLTF |
| (restricted) Ga0315314_13146791 | 3300031877 | Sediment | YLEQVEQLVAEQVPQEELAVLLNLPPLEKAKADIIR |
| Ga0214473_1000690915 | 3300031949 | Soil | VPQVEQLVAEQPPQEELAVLLNFSPLEKAKADIIR |
| Ga0214473_105375181 | 3300031949 | Soil | VPQVEQLVDEQVPQDELAVLLNFPPLEKAKADIIRLTFLLLHLGQAIF |
| Ga0214473_105880502 | 3300031949 | Soil | LPQVEQLVDEQVPQEEPAVLLNFPPLEKANEDIIRLTFLFLH |
| Ga0315274_100605062 | 3300031999 | Sediment | LPQVEQLLDEQVPQEELAVLLNFPPLEKAKADIIRLTFLLLH |
| Ga0315274_102437031 | 3300031999 | Sediment | LLQPEQLLDEQEPHEELAVLLNFPPTEKAKADMTRVTFL |
| Ga0315284_107653302 | 3300032053 | Sediment | LLQPEQLLDEQEPHEELAVLLNFPPTEKAKADMTRVT |
| Ga0315282_100591164 | 3300032069 | Sediment | VPQVEQLADEQVPQEELAVLLNFPPLEKAKEDIIRFTFLLLH |
| Ga0315282_103829552 | 3300032069 | Sediment | VLQVEQLVAEQVPQDELAVLLNFPPLEKAKADIIRLTFLLLH |
| Ga0315277_107078792 | 3300032118 | Sediment | LEQVEQLLDEQVPQEELAVLLNLPPLEKAKADIIR |
| Ga0315295_102511912 | 3300032156 | Sediment | VEQLVEEQPPQEELAVLLNFPPLEKAKADIIRLTLLFLHSGQIIF |
| Ga0315281_107441552 | 3300032163 | Sediment | VEQLVEEQPLQEELAVLLNFPPLEKAKEDIIRLTFLF |
| Ga0315281_108955472 | 3300032163 | Sediment | LEPQVEQLVDEQVPQEEPAVLLNFPPLEKANEDIIRLTFLLLH |
| Ga0315281_112274342 | 3300032163 | Sediment | LEPQVEQVVAAQPLQEELAVLLNLPPLEKAKADIIR |
| Ga0315275_116830952 | 3300032401 | Sediment | VDEQVPQDELAVLLNFPLLEKAKADIIRLTFLLLHLGQAI |
| Ga0335070_100665651 | 3300032829 | Soil | LEPQVEQLVAAQPLHEELAVLLNLPPLEKAKADIIR |
| Ga0335081_101033953 | 3300032892 | Soil | LEPQVEQVVAEQVPQEEPAVLLNFPPTEKAKADITR |
| Ga0335084_102676162 | 3300033004 | Soil | VPQVEQLVAAHPLQEELAVLLNFPPLEKAKADIVR |
| Ga0316603_103045372 | 3300033413 | Soil | LWRCRVHLLQPEQLLEEQPPQEELAVLVNFPPLEKAKEDIFRLTFFVLHLG |
| Ga0316603_108518121 | 3300033413 | Soil | VEQLVAPQLPQEEDAVLLNFPPLEKAKADIIRPTFLLLHL |
| Ga0316603_121409302 | 3300033413 | Soil | LEDEQLPQEELAVLLNFPPTENAKADITRRTFLLLHLGQAIF |
| Ga0316601_1009948551 | 3300033419 | Soil | LEPQLEQLLDEQVPQEELAVLLNFPPLEKAKADIIRLTFLLLHCGQ |
| Ga0326726_102013522 | 3300033433 | Peat Soil | LEPQVEQLADEQVPQEELAVLLSFPPTEKANADIIRLTFLLLH |
| Ga0326726_103010292 | 3300033433 | Peat Soil | LEPQVEQVVAEQAPQEELAVLLNFPPTEKAKADITR |
| Ga0316620_101924423 | 3300033480 | Soil | LELQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIR |
| Ga0316620_104542861 | 3300033480 | Soil | LPQVEQLVDEQVPQEELAVLLNFPPTEKANEDIIRLTFLLLH |
| Ga0316620_106397872 | 3300033480 | Soil | LEPQVVQLVAEQPPQEELAVLLNFPPLEKAKADIIR |
| Ga0316620_106648752 | 3300033480 | Soil | LGFNGYLEPQVEQLVAEQPPQEELAVLLNFPPLEKAKADITR |
| Ga0316620_114063912 | 3300033480 | Soil | MGGVLYLEPQVEQLGEAQLPQEEPAVLLNFPPTEKANADIIR |
| Ga0316600_104662801 | 3300033481 | Soil | VEQLLGDEQLPQEELAVLLNFPPTEKAKADMTRRTFLLLHLGQAIFSEL |
| Ga0316624_103573992 | 3300033486 | Soil | LEPQVEQVVAEQVPQEELAVLLNFPPTEKAKADITR |
| Ga0316624_110702702 | 3300033486 | Soil | LEPQVEQVVAEHVPQEEPAVLLNFPPTDKAKADITR |
| Ga0316630_103301492 | 3300033487 | Soil | LLQVEQLVAAQPPQEELAVLLNFPPTEKAKADIMR |
| Ga0299912_100631772 | 3300033489 | Soil | LLQVEQVVAAQPLQEELAVLLNFPPLEKAKADIIL |
| Ga0299912_104096551 | 3300033489 | Soil | VDEQVPQDELAVLLNFPPLEKAKADIIRLTFLLLHL |
| Ga0314863_029360_1_108 | 3300033804 | Peatland | EPQVEQLVAAQPLQEELAVLLNFPPTEKAKADIIR |
| Ga0314861_0089496_3_116 | 3300033977 | Peatland | YFEPQVEQVVAEQVPQEEPAVLLNFPPTEKAKADITR |
| Ga0373901_103033_2_115 | 3300034083 | Sediment Slurry | YLEPQVEQVVAAQPLQEELAVLLNFPLLEKAKADIIL |
| Ga0326723_0586787_25_132 | 3300034090 | Peat Soil | LEQVEQLVAAQPPQDELAVLLNFPPTEKAKADMIR |
| Ga0364942_0264929_54_164 | 3300034165 | Sediment | LVPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR |
| Ga0373916_0005168_1276_1386 | 3300034894 | Sediment Slurry | LEPQVEQLVAEQPPQEELAVLLNFPPLEKAKGDIVR |
| ⦗Top⦘ |