


| Basic Information | |
|---|---|
| Family ID | F090995 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKAREIKIRKTILFTKARPFKMKNKILDRKLKHKKQYEY |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 45.37 % |
| % of genes from short scaffolds (< 2000 bps) | 62.04 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.481 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.296 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.407 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.97% β-sheet: 0.00% Coil/Unstructured: 94.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 24.07 |
| PF02562 | PhoH | 1.85 |
| PF04851 | ResIII | 0.93 |
| PF04545 | Sigma70_r4 | 0.93 |
| PF00415 | RCC1 | 0.93 |
| PF02976 | MutH | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.85 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.85 |
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 1.85 |
| COG3066 | DNA mismatch repair protein MutH | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.48 % |
| All Organisms | root | All Organisms | 43.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10098582 | Not Available | 1078 | Open in IMG/M |
| 3300000928|OpTDRAFT_10250241 | Not Available | 588 | Open in IMG/M |
| 3300000928|OpTDRAFT_10264265 | Not Available | 1132 | Open in IMG/M |
| 3300000929|NpDRAFT_10111484 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1040 | Open in IMG/M |
| 3300000930|BpDRAFT_10050383 | Not Available | 3746 | Open in IMG/M |
| 3300001347|JGI20156J14371_10194988 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
| 3300001352|JGI20157J14317_10018291 | Not Available | 4132 | Open in IMG/M |
| 3300001450|JGI24006J15134_10172169 | Not Available | 687 | Open in IMG/M |
| 3300004097|Ga0055584_100499803 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300004448|Ga0065861_1050059 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 929 | Open in IMG/M |
| 3300004457|Ga0066224_1230195 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300005934|Ga0066377_10005803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 3029 | Open in IMG/M |
| 3300005941|Ga0070743_10001259 | All Organisms → cellular organisms → Bacteria | 9729 | Open in IMG/M |
| 3300005941|Ga0070743_10023292 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300005941|Ga0070743_10026003 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
| 3300005946|Ga0066378_10086314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 974 | Open in IMG/M |
| 3300006752|Ga0098048_1201725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 587 | Open in IMG/M |
| 3300006790|Ga0098074_1015685 | Not Available | 2362 | Open in IMG/M |
| 3300006793|Ga0098055_1392147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 514 | Open in IMG/M |
| 3300006810|Ga0070754_10028818 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300006868|Ga0075481_10002629 | Not Available | 7151 | Open in IMG/M |
| 3300006869|Ga0075477_10392528 | Not Available | 541 | Open in IMG/M |
| 3300006916|Ga0070750_10091720 | Not Available | 1416 | Open in IMG/M |
| 3300006916|Ga0070750_10418154 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 558 | Open in IMG/M |
| 3300006924|Ga0098051_1001671 | All Organisms → cellular organisms → Bacteria | 8069 | Open in IMG/M |
| 3300007236|Ga0075463_10202424 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 639 | Open in IMG/M |
| 3300007539|Ga0099849_1001090 | Not Available | 12668 | Open in IMG/M |
| 3300007539|Ga0099849_1005350 | All Organisms → cellular organisms → Bacteria | 5867 | Open in IMG/M |
| 3300007554|Ga0102820_1034248 | Not Available | 1241 | Open in IMG/M |
| 3300008050|Ga0098052_1243530 | Not Available | 689 | Open in IMG/M |
| 3300008470|Ga0115371_11201881 | Not Available | 1398 | Open in IMG/M |
| 3300009000|Ga0102960_1017243 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
| 3300009001|Ga0102963_1029689 | Not Available | 2287 | Open in IMG/M |
| 3300009130|Ga0118729_1242652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 623 | Open in IMG/M |
| 3300009172|Ga0114995_10070667 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
| 3300009409|Ga0114993_10499735 | Not Available | 904 | Open in IMG/M |
| 3300009420|Ga0114994_10366744 | Not Available | 955 | Open in IMG/M |
| 3300009705|Ga0115000_10872758 | Not Available | 550 | Open in IMG/M |
| 3300009706|Ga0115002_10152622 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300009785|Ga0115001_10067799 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
| 3300010297|Ga0129345_1009489 | Not Available | 3798 | Open in IMG/M |
| 3300010318|Ga0136656_1300198 | Not Available | 522 | Open in IMG/M |
| 3300010883|Ga0133547_11319842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1368 | Open in IMG/M |
| 3300012919|Ga0160422_10022269 | All Organisms → Viruses → Predicted Viral | 3676 | Open in IMG/M |
| 3300017729|Ga0181396_1069849 | Not Available | 705 | Open in IMG/M |
| 3300017744|Ga0181397_1009537 | Not Available | 3014 | Open in IMG/M |
| 3300017746|Ga0181389_1001703 | All Organisms → cellular organisms → Bacteria | 8502 | Open in IMG/M |
| 3300017767|Ga0181406_1247310 | Not Available | 524 | Open in IMG/M |
| 3300017824|Ga0181552_10063223 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300017824|Ga0181552_10408257 | Not Available | 650 | Open in IMG/M |
| 3300017951|Ga0181577_10215506 | Not Available | 1277 | Open in IMG/M |
| 3300017956|Ga0181580_10210620 | Not Available | 1359 | Open in IMG/M |
| 3300017985|Ga0181576_10782340 | Not Available | 565 | Open in IMG/M |
| 3300018036|Ga0181600_10565853 | Not Available | 533 | Open in IMG/M |
| 3300018036|Ga0181600_10599914 | Not Available | 514 | Open in IMG/M |
| 3300018416|Ga0181553_10155401 | Not Available | 1357 | Open in IMG/M |
| 3300018423|Ga0181593_11040277 | Not Available | 560 | Open in IMG/M |
| 3300019765|Ga0194024_1148331 | Not Available | 550 | Open in IMG/M |
| 3300020185|Ga0206131_10015457 | Not Available | 6660 | Open in IMG/M |
| 3300020188|Ga0181605_10409482 | Not Available | 535 | Open in IMG/M |
| 3300020191|Ga0181604_10065952 | All Organisms → Viruses → Predicted Viral | 2047 | Open in IMG/M |
| 3300020339|Ga0211605_1048666 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 859 | Open in IMG/M |
| 3300020346|Ga0211607_1066695 | Not Available | 730 | Open in IMG/M |
| 3300020347|Ga0211504_1015266 | Not Available | 2167 | Open in IMG/M |
| 3300020403|Ga0211532_10058096 | Not Available | 1781 | Open in IMG/M |
| 3300020442|Ga0211559_10199065 | Not Available | 946 | Open in IMG/M |
| 3300021068|Ga0206684_1112524 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300021085|Ga0206677_10002910 | Not Available | 14706 | Open in IMG/M |
| 3300021379|Ga0213864_10119276 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300021443|Ga0206681_10061309 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300021957|Ga0222717_10057491 | Not Available | 2505 | Open in IMG/M |
| 3300022198|Ga0196905_1047114 | Not Available | 1238 | Open in IMG/M |
| 3300022907|Ga0255775_1216007 | Not Available | 721 | Open in IMG/M |
| 3300022914|Ga0255767_1006159 | All Organisms → cellular organisms → Bacteria | 9472 | Open in IMG/M |
| 3300022937|Ga0255770_10458486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 537 | Open in IMG/M |
| 3300023108|Ga0255784_10112733 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10013825 | All Organisms → cellular organisms → Bacteria | 6255 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10315374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 716 | Open in IMG/M |
| 3300023110|Ga0255743_10373277 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 712 | Open in IMG/M |
| 3300023116|Ga0255751_10280840 | Not Available | 880 | Open in IMG/M |
| 3300023180|Ga0255768_10269928 | Not Available | 974 | Open in IMG/M |
| 3300024301|Ga0233451_10350520 | Not Available | 549 | Open in IMG/M |
| 3300024346|Ga0244775_10004364 | All Organisms → cellular organisms → Bacteria | 14702 | Open in IMG/M |
| 3300024346|Ga0244775_10402180 | Not Available | 1126 | Open in IMG/M |
| 3300025084|Ga0208298_1036733 | Not Available | 1001 | Open in IMG/M |
| 3300025653|Ga0208428_1002606 | All Organisms → cellular organisms → Bacteria | 7243 | Open in IMG/M |
| 3300025674|Ga0208162_1002480 | Not Available | 9043 | Open in IMG/M |
| 3300025674|Ga0208162_1004130 | All Organisms → cellular organisms → Bacteria | 6850 | Open in IMG/M |
| 3300025771|Ga0208427_1007694 | All Organisms → cellular organisms → Bacteria | 4307 | Open in IMG/M |
| 3300025870|Ga0209666_1137412 | Not Available | 1128 | Open in IMG/M |
| 3300026083|Ga0208878_1000664 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 11827 | Open in IMG/M |
| 3300026187|Ga0209929_1014647 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
| 3300027571|Ga0208897_1014962 | All Organisms → Viruses → Predicted Viral | 2263 | Open in IMG/M |
| 3300027751|Ga0208304_10006604 | All Organisms → cellular organisms → Bacteria | 4987 | Open in IMG/M |
| 3300027791|Ga0209830_10197716 | Not Available | 938 | Open in IMG/M |
| 3300027801|Ga0209091_10237567 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 891 | Open in IMG/M |
| 3300027847|Ga0209402_10027650 | Not Available | 4297 | Open in IMG/M |
| 3300028115|Ga0233450_10339749 | Not Available | 620 | Open in IMG/M |
| 3300029448|Ga0183755_1008842 | All Organisms → cellular organisms → Bacteria | 4159 | Open in IMG/M |
| 3300031519|Ga0307488_10741554 | Not Available | 550 | Open in IMG/M |
| 3300031566|Ga0307378_10847470 | Not Available | 764 | Open in IMG/M |
| 3300031578|Ga0307376_10109240 | Not Available | 1940 | Open in IMG/M |
| 3300031601|Ga0307992_1146644 | Not Available | 916 | Open in IMG/M |
| 3300031606|Ga0302119_10040432 | Not Available | 1961 | Open in IMG/M |
| 3300031621|Ga0302114_10026966 | Not Available | 3001 | Open in IMG/M |
| 3300031627|Ga0302118_10548486 | Not Available | 503 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.30% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 19.44% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.04% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.56% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.56% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.70% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 3.70% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.70% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.78% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.78% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.85% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.93% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.93% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020339 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX555929-ERR599080) | Environmental | Open in IMG/M |
| 3300020346 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556057-ERR599069) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022914 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100985823 | 3300000117 | Marine | MKAREVKARKPILFTKARAFKMNNKILDRKLKHKKNYVLHS* |
| OpTDRAFT_102502412 | 3300000928 | Freshwater And Marine | MKARXXXXXXXXXFTKARPFKMKNKTLDRKLKHKKNYVYS* |
| OpTDRAFT_102642655 | 3300000928 | Freshwater And Marine | IMKAKKIKIRQSILFTKARPFKMKNKILDRKLKHKTKLNYVS* |
| NpDRAFT_101114842 | 3300000929 | Freshwater And Marine | MPYYVYMKVREIKIRQKILFTKARPFKMRNKILDRKLKHKTKLA* |
| BpDRAFT_1005038311 | 3300000930 | Freshwater And Marine | VREIKIRQKILFTKARPFKMRNKILDRKQKHKTKLA* |
| JGI20156J14371_101949882 | 3300001347 | Pelagic Marine | MPYYVYMKVREIKIRQKILFTKARPFKMRNKILDRKLKHKTKLS* |
| JGI20157J14317_100182915 | 3300001352 | Pelagic Marine | MKARDIKIRKPILFTKARAFKIKNKVLDRKLKHKKNYVLYP* |
| JGI24006J15134_101721693 | 3300001450 | Marine | MYIMKVKELKIRKPILFTKARPFKMKNKILPRKQKHKEQL* |
| Ga0055584_1004998033 | 3300004097 | Pelagic Marine | PYYVYMKTREIKIRKTILFTKARPFKMRNKILDRKLKHKKQYEY* |
| Ga0065861_10500591 | 3300004448 | Marine | MPYYVYMKVREIKIRKQILFTKARPFKMKNKVLHRKLKHKTKLA* |
| Ga0066224_12301955 | 3300004457 | Marine | MKAREIKIRKQILFTKARPFKMKNKTLDRKLKHKKRYEY* |
| Ga0066377_100058039 | 3300005934 | Marine | MYMKTREIKIRKPILFTKSRPHKVKTRTIHRKLKHKEQLT* |
| Ga0070743_1000125910 | 3300005941 | Estuarine | MKVREIKIRKTIIFTKSRPHKVKTKTLHRKQKHKKILFKY* |
| Ga0070743_100232925 | 3300005941 | Estuarine | KLAYYVYMKAREINIRKPILFTKARPHKIKAKVIHRKLKHKEQLV* |
| Ga0070743_100260031 | 3300005941 | Estuarine | YVYMKAREVKVRKPILFTKARAFRMNNKVLDRKLKHKKNYVLYT* |
| Ga0066378_100863143 | 3300005946 | Marine | MYMKAREIKIRKPILFTKARPFKLKNKILDRKQKHKIRYEY* |
| Ga0098048_12017252 | 3300006752 | Marine | MPYYVYMKAREIKIRKTILFTKARPFKMRNKILDRKLKHKTKLA* |
| Ga0098074_10156855 | 3300006790 | Marine | MEGMNNREVKIRKPILFTKSRPHKVKTKVIHRKLKHKEQL* |
| Ga0098055_13921471 | 3300006793 | Marine | MPYYVYMKAREIKIRKPILFTKARPFKMRNKILDRKLKHKTKLA* |
| Ga0070754_100288186 | 3300006810 | Aqueous | MTVREIKIRKTILFTKSRPHKVKTKILDRKKKHKLKLSIDNQS* |
| Ga0075481_100026295 | 3300006868 | Aqueous | MKAKEIKIRKQILFTKARPFKMKNKILDRKQKHKTKLTYVS* |
| Ga0075477_103925281 | 3300006869 | Aqueous | KVREIKIRKTILFTKSRPHKVKTKILDRKKKHKLKLSIDNQS* |
| Ga0070750_100917203 | 3300006916 | Aqueous | MKAREVKVRKPFLFTKSRPHKTRVKTIHRKLKHKE |
| Ga0070750_104181541 | 3300006916 | Aqueous | MKAREIKIRKQILFTKARPFKMKNKILDRKLKHKKRYEY* |
| Ga0098051_100167114 | 3300006924 | Marine | MKTREIKIRKTMIFTKARPHKLKNKILDRKQKHRKNITNEY* |
| Ga0075463_102024243 | 3300007236 | Aqueous | MKTREIKIRKTILFTKARPFKMRNKILDRKLKHKKQYEY* |
| Ga0099849_10010905 | 3300007539 | Aqueous | MKTREIKIRKTILFTKARPHKLKNKILDRKEKHRKNITNEY* |
| Ga0099849_10053508 | 3300007539 | Aqueous | MYTMKAREIKIRKTILFTKSRPHKVKTKTIHRKLKHKEQLS* |
| Ga0102820_10342481 | 3300007554 | Estuarine | KLAYYVYMKAREIKIRKQILFTKARPFKMKNKVLHRKLKHKTKLA* |
| Ga0098052_12435303 | 3300008050 | Marine | VRKLKIRKPILFTKARPFKMRNKILPRKQKHKEQV* |
| Ga0115371_112018812 | 3300008470 | Sediment | MKAKELKIRKPILFTKARPFKMRNKTLARKLKHKEQL* |
| Ga0102960_10172431 | 3300009000 | Pond Water | MYTMKAREIKIRKKILFTKSRPHKVKNKTIHRKLKHKEQLS* |
| Ga0102963_10296892 | 3300009001 | Pond Water | MYTMKAREIKIRKKILFTKSRPHKVKTKTIHRKLKHKEQLS* |
| Ga0118729_12426521 | 3300009130 | Marine | MKTKGIKIRKPILFTKARPFKMKNKTLDRKLKHRKSYEY* |
| Ga0114995_100706671 | 3300009172 | Marine | VIIYIMKATEIKIRKTMIFSKARPFKMKNKILDRKLKHKTKLS* |
| Ga0114993_104997353 | 3300009409 | Marine | RELKIRKTILFTKARPFKMRNKILPRKQKHKEQA* |
| Ga0114994_103667443 | 3300009420 | Marine | MKAKEIKIRKTILFTKARPFKMRNKTLARKLKHKEQL* |
| Ga0115000_108727581 | 3300009705 | Marine | MKIRELKIRKPILFTKARPFKMRNKTLARKLKHKEQL* |
| Ga0115002_101526221 | 3300009706 | Marine | IMKIRELKIRKPILFTKARPFKMRNKILPRKLKHKEQL* |
| Ga0115001_100677993 | 3300009785 | Marine | MKATEIKIRKTMIFSKARPFKMKNKILDRKLKHKTKLS* |
| Ga0129345_10094899 | 3300010297 | Freshwater To Marine Saline Gradient | MPYYAYMKTREIKIRKTILFTKARPFKMRNKILDRKLKHKKQYEY* |
| Ga0136656_13001981 | 3300010318 | Freshwater To Marine Saline Gradient | REVKVRKPILFTKARPHKVRVKTIHRKLKHKEALV* |
| Ga0133547_113198421 | 3300010883 | Marine | MKVREIKIRQKILFTKARPFKMRNKILDRKLKHKTKL |
| Ga0160422_1002226911 | 3300012919 | Seawater | MKARELKIRKPILFTKARPFKMKNKILDRKRKHKIRYEY* |
| Ga0181396_10698493 | 3300017729 | Seawater | YVYMKAREIKIRKQILFTKARPFKMKNKILDRKQKHKKQYEY |
| Ga0181397_10095374 | 3300017744 | Seawater | MKAREIKIRKQILFTKARPFKMKNKILDRKQKHKKQYEY |
| Ga0181389_10017038 | 3300017746 | Seawater | MPYYVHMKAREIKIRKTILFTKARPFKMKNKVLDRKLKHKKQYEY |
| Ga0181406_12473102 | 3300017767 | Seawater | MKVREIKIRKTMIFTKSRPHKVKKNTLHRKQKHKENLN |
| Ga0181552_100632231 | 3300017824 | Salt Marsh | KAREIKIRKTILFTKARPHKVKAKVIHRKLKHKEQLV |
| Ga0181552_104082572 | 3300017824 | Salt Marsh | MKAREVKVRKPILFTKARPHKVRVKTIHRKLKHKEALV |
| Ga0181577_102155063 | 3300017951 | Salt Marsh | MKAREIKIRKTILFTKARPHKVKAKVIHRKLKHKEQLV |
| Ga0181580_102106203 | 3300017956 | Salt Marsh | KTREIKIRKTILFTKARPHKLKNKILDRKLKHRKNITNEY |
| Ga0181576_107823403 | 3300017985 | Salt Marsh | VYMKAREIKIRKTILFTKARPHKVKAKVIHRKLKHKEQLV |
| Ga0181600_105658531 | 3300018036 | Salt Marsh | YVYMKAREVKVRKPILFTKARPHKVRVKTIHRKLKHKEALV |
| Ga0181600_105999141 | 3300018036 | Salt Marsh | REVKVRKPILFTKARPHKVRVKTIHRKLKHKEVLV |
| Ga0181553_101554011 | 3300018416 | Salt Marsh | AREIKIRKTILFTKARPHKVKAKVIHRKLKHKEQLV |
| Ga0181593_110402771 | 3300018423 | Salt Marsh | YHISMKAVKIRKSILFTKSRPHKIKSKIIHRKMKYKEILNK |
| Ga0181591_101078011 | 3300018424 | Salt Marsh | MKIKFRKPILVFSKSRPHKVKTKVLHRKMKHKQTLL |
| Ga0194024_11483312 | 3300019765 | Freshwater | MIKIRKKILFTKSRPHKLKTKVIHRKLKHKEVLTHA |
| Ga0206131_100154577 | 3300020185 | Seawater | MPYYVYMKVREIKIRQKILFTKARPFKMRNKILDRKLKHKTKLS |
| Ga0181605_104094823 | 3300020188 | Salt Marsh | MIKIRKTILFTKSRPHKVKTKVIHRKLKHKESLKNVH |
| Ga0181604_100659521 | 3300020191 | Salt Marsh | REVKVRKPILFTKARPHKVRVKTIHRKLKHKEALV |
| Ga0211605_10486663 | 3300020339 | Marine | MYMMRGKKIKVRKPILFTKARPFKMKNKILDRKLKHKIRYEY |
| Ga0211607_10666953 | 3300020346 | Marine | KKIKVRKPILFTKARPFKMKNKILDRKLKHKIRYEY |
| Ga0211504_10152665 | 3300020347 | Marine | MAYYVYMKAREIKIRKTILFTKARPFKMKNKILDRKLKHRKQYEY |
| Ga0211532_100580964 | 3300020403 | Marine | MPYYVYMKAREIKIRKTILFTKARPFKMKNKILDRKLKHKKSYKIEFNY |
| Ga0211559_101990653 | 3300020442 | Marine | MKAREIKIRKTILFTKARPFKMKNKILDRKLKHKKQYEY |
| Ga0206684_11125241 | 3300021068 | Seawater | MKVRKLKIRKPILFTKARPFKMRNKILPRKQKHKEQ |
| Ga0206677_100029106 | 3300021085 | Seawater | MPYYVYMKAREIKIRKQILFTKARPFKIKNKILDRKQKHKKQYEY |
| Ga0213864_101192761 | 3300021379 | Seawater | MKAIKVRKPILFTKSRPHKIKSKIIHRKMKYKENLNK |
| Ga0206681_100613093 | 3300021443 | Seawater | MKAKEIKIRKPILFTKARPFKMRNKILPRKQKHKEQV |
| Ga0206681_100849173 | 3300021443 | Seawater | MQPKIRLKVLFTKSRPFKRKNKVLHRKAKHKKSEIGG |
| Ga0222717_100574911 | 3300021957 | Estuarine Water | IAYYTYMKAREIKIRKAIVFTKSRPHKVKSKTLHRKQKYKEALNVYS |
| Ga0196905_10471143 | 3300022198 | Aqueous | MKAREVKVRKPILFTKARPHKVRVKTIHRKLKHKE |
| Ga0255775_12160071 | 3300022907 | Salt Marsh | YVYMKAREIKIRKPILFTKARPHKVKAKVIHRKLKHKEQLV |
| Ga0255767_10061591 | 3300022914 | Salt Marsh | REIKIRKTILFTKARPHKLKNKILDRKLKHRKNITNEY |
| Ga0255770_104584861 | 3300022937 | Salt Marsh | MKAREIKIRKTILFTKARPHKVKAKVIHRKLKHKEQLVXK |
| Ga0255784_101127334 | 3300023108 | Salt Marsh | MKAIKVRKPILFTKSRPHKIKSKIIHRKMKYKENLN |
| (restricted) Ga0233432_1001382512 | 3300023109 | Seawater | MPYYVYMKVREIKIRQKILFTKARPFKMRNKILDRKQKHKTKLA |
| (restricted) Ga0233432_103153742 | 3300023109 | Seawater | VLFKKLAYYVYMKAREINIRKPILFTKARPHKVKAKVIHRKLK |
| Ga0255743_103732772 | 3300023110 | Salt Marsh | MKAREIKIRKTILFTKARPHKVKAKVIHRKLKHKEQ |
| Ga0255751_102808403 | 3300023116 | Salt Marsh | KAREVKVRKPILFTKSRPHKIRIKTIHRKLKHKEALV |
| Ga0255768_102699282 | 3300023180 | Salt Marsh | MKAREVKVRKPILFTKARPHKVRVKTIHRKLKHKEA |
| Ga0233451_103505201 | 3300024301 | Salt Marsh | MKAREVKVGKPILFTKARPHKVRVKTIHRKLKHKEALV |
| Ga0244775_1000436419 | 3300024346 | Estuarine | MKVREIKIRKTIIFTKSRPHKVKTKTLHRKQKHKKILFKY |
| Ga0244775_104021801 | 3300024346 | Estuarine | YVYMKAREINIRKPILFTKARPHKVKAKVIHRKLKHKEQLV |
| Ga0208298_10367333 | 3300025084 | Marine | MKTREIKIRKTMIFTKARPHKLKNKILDRKQKHRKNITNEY |
| Ga0208428_100260617 | 3300025653 | Aqueous | MKAKEIKIRKQILFTKARPFKMKNKILDRKQKHKTKLTYVS |
| Ga0208162_100248013 | 3300025674 | Aqueous | MKTREIKIRKTILFTKARPHKLKNKILDRKEKHRKNITNEY |
| Ga0208162_100413010 | 3300025674 | Aqueous | MRYYVYMKTREIKIRKAILFTKARPFKMRNKILDRKLKHKKQYEY |
| Ga0208427_10076941 | 3300025771 | Aqueous | MKAREVKVRKPFLFTKSRPHKTRIKTIHRKLKHKEVLV |
| Ga0209666_11374123 | 3300025870 | Marine | MKAREIKIRKTILFTKARPFKMKNKVLDRKLKHKKQYEY |
| Ga0208878_10006641 | 3300026083 | Marine | MYMKAREIKIRKPILFTKARPFKLKNKILDRKQKHKIRYEY |
| Ga0209929_10146472 | 3300026187 | Pond Water | MYTMKAREIKIRKKILFTKSRPHKVKNKTIHRKLKHKEQLS |
| Ga0208897_10149621 | 3300027571 | Estuarine | YVYMKAREVKVRKPILFTKARAFRMNNKVLDRKLKHKKNYVLYT |
| Ga0208304_100066041 | 3300027751 | Estuarine | YMKVREIKIRKTIIFTKSRPHKVKTKTLHRKQKHKKILFKY |
| Ga0209830_101977161 | 3300027791 | Marine | MKATEIKIRKTMIFSKARPFKMKNKILDRKLKHKTKLS |
| Ga0209091_102375672 | 3300027801 | Marine | MKAKEIKIRKTILFTKARPFKMRNKTLARKLKHKEQL |
| Ga0209402_100276506 | 3300027847 | Marine | MKIRELKIRKPILFTKARPFKMRNKTLARKLKHKEQL |
| Ga0233450_103397493 | 3300028115 | Salt Marsh | SLFLCDIVYMKAREIKIRKPILFTKSRPHQDKSKIIHRKLKHKEKLS |
| Ga0183755_100884213 | 3300029448 | Marine | MKVREIKIRKTIIFTKSRPHKLNNKTLDRKKKHKSKLTIDNQY |
| Ga0307488_107415543 | 3300031519 | Sackhole Brine | REIKIRQKILFTKARPFKMRNKILDRKLKHKTKLS |
| Ga0307378_108474703 | 3300031566 | Soil | IYIMKAKKFKMRKPILFTKARPFKMRNKILPRNQKHKEQV |
| Ga0307376_101092408 | 3300031578 | Soil | MKAKKFKMRKPILFTKARPFKMRNKILPRNQKHKE |
| Ga0307992_11466442 | 3300031601 | Marine | MKAKELKIRKPILFTKARPFKMRNKTLARKLKHKEQL |
| Ga0302119_100404324 | 3300031606 | Marine | MRNKKIKIRKTMIFTKARPHGMKNKTLGRKLKHRKDISDEN |
| Ga0302114_100269665 | 3300031621 | Marine | MPYYVYMKAREIKIRQKILFTKARPFKMMNKILDRKLKHKTKLA |
| Ga0302118_105484862 | 3300031627 | Marine | IMKLRKLKIRKPILFTKARPFKMRNKILPRNQKHKEQL |
| ⦗Top⦘ |