


| Basic Information | |
|---|---|
| Family ID | F090994 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.62 % |
| % of genes near scaffold ends (potentially truncated) | 57.41 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.852 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (30.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.741 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 87.50% β-sheet: 0.00% Coil/Unstructured: 12.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF11284 | DUF3085 | 9.26 |
| PF03237 | Terminase_6N | 2.78 |
| PF02609 | Exonuc_VII_S | 0.93 |
| PF02021 | UPF0102 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.93 |
| COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.85 % |
| All Organisms | root | All Organisms | 23.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10074700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1537 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10108489 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 893 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10146078 | Not Available | 707 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10084261 | Not Available | 1248 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10158883 | Not Available | 765 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10086960 | Not Available | 1195 | Open in IMG/M |
| 3300001352|JGI20157J14317_10032610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 2693 | Open in IMG/M |
| 3300001355|JGI20158J14315_10223160 | Not Available | 526 | Open in IMG/M |
| 3300001450|JGI24006J15134_10173481 | Not Available | 683 | Open in IMG/M |
| 3300001450|JGI24006J15134_10255976 | Not Available | 500 | Open in IMG/M |
| 3300001460|JGI24003J15210_10169563 | Not Available | 539 | Open in IMG/M |
| 3300001472|JGI24004J15324_10157118 | Not Available | 519 | Open in IMG/M |
| 3300003427|JGI26084J50262_1114084 | Not Available | 541 | Open in IMG/M |
| 3300005182|Ga0069000_10145981 | Not Available | 616 | Open in IMG/M |
| 3300005346|Ga0074242_10577336 | All Organisms → cellular organisms → Bacteria | 3567 | Open in IMG/M |
| 3300005512|Ga0074648_1091840 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300005882|Ga0080455_1146175 | Not Available | 529 | Open in IMG/M |
| 3300006026|Ga0075478_10099220 | Not Available | 930 | Open in IMG/M |
| 3300006026|Ga0075478_10255453 | Not Available | 524 | Open in IMG/M |
| 3300006027|Ga0075462_10019304 | Not Available | 2200 | Open in IMG/M |
| 3300006027|Ga0075462_10039688 | Not Available | 1506 | Open in IMG/M |
| 3300006027|Ga0075462_10042532 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 1452 | Open in IMG/M |
| 3300006029|Ga0075466_1142265 | Not Available | 622 | Open in IMG/M |
| 3300006029|Ga0075466_1167677 | Not Available | 557 | Open in IMG/M |
| 3300006735|Ga0098038_1126807 | Not Available | 864 | Open in IMG/M |
| 3300006737|Ga0098037_1044474 | Not Available | 1609 | Open in IMG/M |
| 3300006737|Ga0098037_1177908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 704 | Open in IMG/M |
| 3300006810|Ga0070754_10527494 | Not Available | 506 | Open in IMG/M |
| 3300006869|Ga0075477_10047148 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300006916|Ga0070750_10234667 | Not Available | 801 | Open in IMG/M |
| 3300006920|Ga0070748_1333818 | Not Available | 536 | Open in IMG/M |
| 3300006922|Ga0098045_1017426 | Not Available | 1949 | Open in IMG/M |
| 3300006928|Ga0098041_1016518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2427 | Open in IMG/M |
| 3300007236|Ga0075463_10107103 | Not Available | 902 | Open in IMG/M |
| 3300007345|Ga0070752_1130979 | Not Available | 1046 | Open in IMG/M |
| 3300007346|Ga0070753_1233907 | Not Available | 671 | Open in IMG/M |
| 3300007538|Ga0099851_1051281 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300007538|Ga0099851_1265749 | Not Available | 611 | Open in IMG/M |
| 3300007539|Ga0099849_1250539 | Not Available | 651 | Open in IMG/M |
| 3300007540|Ga0099847_1249716 | Not Available | 509 | Open in IMG/M |
| 3300007541|Ga0099848_1211369 | Not Available | 692 | Open in IMG/M |
| 3300007640|Ga0070751_1323004 | Not Available | 571 | Open in IMG/M |
| 3300007778|Ga0102954_1137351 | Not Available | 697 | Open in IMG/M |
| 3300007960|Ga0099850_1125581 | Not Available | 1045 | Open in IMG/M |
| 3300007960|Ga0099850_1274171 | Not Available | 645 | Open in IMG/M |
| 3300008012|Ga0075480_10569141 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 539 | Open in IMG/M |
| 3300009001|Ga0102963_1161922 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 899 | Open in IMG/M |
| 3300009001|Ga0102963_1331811 | Not Available | 597 | Open in IMG/M |
| 3300009149|Ga0114918_10518866 | Not Available | 636 | Open in IMG/M |
| 3300009505|Ga0115564_10440461 | Not Available | 633 | Open in IMG/M |
| 3300010148|Ga0098043_1007559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 3671 | Open in IMG/M |
| 3300010150|Ga0098056_1211620 | Not Available | 646 | Open in IMG/M |
| 3300010296|Ga0129348_1159029 | Not Available | 779 | Open in IMG/M |
| 3300010296|Ga0129348_1224193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 636 | Open in IMG/M |
| 3300010297|Ga0129345_1081974 | Not Available | 1208 | Open in IMG/M |
| 3300010299|Ga0129342_1154001 | Not Available | 836 | Open in IMG/M |
| 3300010299|Ga0129342_1300612 | Not Available | 552 | Open in IMG/M |
| 3300010318|Ga0136656_1242381 | Not Available | 595 | Open in IMG/M |
| 3300010368|Ga0129324_10110105 | Not Available | 1179 | Open in IMG/M |
| 3300013010|Ga0129327_10214471 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 975 | Open in IMG/M |
| 3300013010|Ga0129327_10235614 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 932 | Open in IMG/M |
| 3300017697|Ga0180120_10171034 | Not Available | 912 | Open in IMG/M |
| 3300017697|Ga0180120_10371921 | Not Available | 564 | Open in IMG/M |
| 3300017720|Ga0181383_1177957 | Not Available | 568 | Open in IMG/M |
| 3300017734|Ga0187222_1064284 | Not Available | 845 | Open in IMG/M |
| 3300017752|Ga0181400_1048574 | Not Available | 1320 | Open in IMG/M |
| 3300017765|Ga0181413_1197680 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 601 | Open in IMG/M |
| 3300017771|Ga0181425_1044214 | Not Available | 1455 | Open in IMG/M |
| 3300017772|Ga0181430_1145257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 690 | Open in IMG/M |
| 3300017776|Ga0181394_1103894 | Not Available | 906 | Open in IMG/M |
| 3300017782|Ga0181380_1050135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 1496 | Open in IMG/M |
| 3300017824|Ga0181552_10066168 | Not Available | 2077 | Open in IMG/M |
| 3300017950|Ga0181607_10341729 | Not Available | 830 | Open in IMG/M |
| 3300018036|Ga0181600_10038593 | All Organisms → Viruses → Predicted Viral | 3167 | Open in IMG/M |
| 3300018410|Ga0181561_10106165 | Not Available | 1522 | Open in IMG/M |
| 3300018410|Ga0181561_10154980 | Not Available | 1168 | Open in IMG/M |
| 3300019765|Ga0194024_1079029 | Not Available | 742 | Open in IMG/M |
| 3300019938|Ga0194032_1021451 | Not Available | 683 | Open in IMG/M |
| 3300019938|Ga0194032_1028937 | Not Available | 582 | Open in IMG/M |
| 3300020176|Ga0181556_1104670 | Not Available | 1271 | Open in IMG/M |
| 3300020421|Ga0211653_10440407 | Not Available | 559 | Open in IMG/M |
| 3300020601|Ga0181557_1121838 | Not Available | 1137 | Open in IMG/M |
| 3300021373|Ga0213865_10015251 | Not Available | 4370 | Open in IMG/M |
| 3300021958|Ga0222718_10443376 | Not Available | 639 | Open in IMG/M |
| 3300021959|Ga0222716_10256193 | Not Available | 1077 | Open in IMG/M |
| 3300021960|Ga0222715_10023278 | All Organisms → cellular organisms → Bacteria | 4587 | Open in IMG/M |
| 3300022074|Ga0224906_1171817 | Not Available | 603 | Open in IMG/M |
| 3300022169|Ga0196903_1001516 | All Organisms → cellular organisms → Bacteria | 3274 | Open in IMG/M |
| 3300022183|Ga0196891_1007693 | Not Available | 2190 | Open in IMG/M |
| 3300022198|Ga0196905_1012741 | Not Available | 2741 | Open in IMG/M |
| 3300022200|Ga0196901_1189513 | Not Available | 665 | Open in IMG/M |
| 3300022900|Ga0255771_1132799 | Not Available | 1061 | Open in IMG/M |
| 3300022922|Ga0255779_1018980 | Not Available | 5196 | Open in IMG/M |
| 3300022926|Ga0255753_1037245 | Not Available | 3001 | Open in IMG/M |
| 3300022927|Ga0255769_10238366 | Not Available | 775 | Open in IMG/M |
| 3300024262|Ga0210003_1173152 | Not Available | 906 | Open in IMG/M |
| 3300025102|Ga0208666_1002519 | All Organisms → cellular organisms → Bacteria | 7603 | Open in IMG/M |
| 3300025120|Ga0209535_1060623 | Not Available | 1546 | Open in IMG/M |
| 3300025120|Ga0209535_1080690 | All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Leptotrichiaceae → Sebaldella → unclassified Sebaldella → Sebaldella sp. S0638 | 1236 | Open in IMG/M |
| 3300025137|Ga0209336_10192117 | Not Available | 508 | Open in IMG/M |
| 3300025653|Ga0208428_1083830 | Not Available | 916 | Open in IMG/M |
| 3300025671|Ga0208898_1004930 | Not Available | 7574 | Open in IMG/M |
| 3300025695|Ga0209653_1037297 | Not Available | 1992 | Open in IMG/M |
| 3300025759|Ga0208899_1016949 | Not Available | 3768 | Open in IMG/M |
| 3300025759|Ga0208899_1151376 | Not Available | 793 | Open in IMG/M |
| 3300025767|Ga0209137_1004141 | All Organisms → cellular organisms → Bacteria | 11705 | Open in IMG/M |
| 3300025853|Ga0208645_1112006 | Not Available | 1106 | Open in IMG/M |
| 3300025853|Ga0208645_1220529 | Not Available | 655 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 30.56% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.19% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.19% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.33% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.56% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.78% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.78% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.85% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.93% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.93% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.93% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.93% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005882 | Hydrocarbon microbial community from Halfdan Field MHF | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100747001 | 3300000101 | Marine | VAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMIFILVVAFM* |
| DelMOSum2011_101084894 | 3300000115 | Marine | FVKELKSMEGLERFNWYVLKPIALMILILVFAFM* |
| DelMOSum2011_101460784 | 3300000115 | Marine | KSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| DelMOSpr2010_100842611 | 3300000116 | Marine | MKSFNQFXKELKSMEGLERFNWYVLKPIALMILILVFALM* |
| DelMOSpr2010_101588832 | 3300000116 | Marine | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFMGGNN* |
| DelMOWin2010_100869601 | 3300000117 | Marine | KSFNQFVKELKSMEGLERFNWYVLKPIALVICILVVAFM* |
| JGI20157J14317_100326105 | 3300001352 | Pelagic Marine | MKSFNQFVKELKSMEGLERFNWYVLKPIALMIFILVVAFMGGNN* |
| JGI20158J14315_102231601 | 3300001355 | Pelagic Marine | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVV |
| JGI24006J15134_101734812 | 3300001450 | Marine | MESFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM* |
| JGI24006J15134_102559762 | 3300001450 | Marine | MDSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM* |
| JGI24003J15210_101695633 | 3300001460 | Marine | VKELKSMEGLERFNWYVLKPIALMILILVVAFMGGNS* |
| JGI24004J15324_101571181 | 3300001472 | Marine | KELKSMEGLERFNWYVLKPIALMILILVVAFMGGNS* |
| JGI26084J50262_11140842 | 3300003427 | Marine | MKSFNQFVKELKSMEGLERFNWYVLKPIALLICILVVTKSQWIVYQWVTFMGGNN* |
| Ga0069000_101459811 | 3300005182 | Natural And Restored Wetlands | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0074242_105773363 | 3300005346 | Saline Water And Sediment | MKSFNQFVKSLKSMEGLERFNWYVLKPIALMILILVFAFM* |
| Ga0074648_10918402 | 3300005512 | Saline Water And Sediment | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVTKSQWIVYQWITFMGGNN* |
| Ga0080455_11461752 | 3300005882 | Water | MNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM* |
| Ga0075478_100992203 | 3300006026 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAL |
| Ga0075478_102554531 | 3300006026 | Aqueous | VMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0075462_100193044 | 3300006027 | Aqueous | MKSFNQFIKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0075462_100396884 | 3300006027 | Aqueous | MKSFNQFIKELKSMEGLERFNWYVLKPIALMILILVFALM* |
| Ga0075462_100425322 | 3300006027 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVALM* |
| Ga0075466_11422651 | 3300006029 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM* |
| Ga0075466_11676772 | 3300006029 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM* |
| Ga0098038_11268073 | 3300006735 | Marine | MNSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFM* |
| Ga0098037_10444744 | 3300006737 | Marine | MNSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0098037_11779082 | 3300006737 | Marine | MKSFNQFVEELKSMEGLERFNWYVLKPIALIICILVVAFM* |
| Ga0070754_105274941 | 3300006810 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFMGGNN* |
| Ga0075477_100471481 | 3300006869 | Aqueous | VMKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFALM* |
| Ga0070750_102346674 | 3300006916 | Aqueous | EVDVMKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM* |
| Ga0070748_13338181 | 3300006920 | Aqueous | AVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0098045_10174263 | 3300006922 | Marine | MKNFNQFVEELKSMEGLERFNWYVLKPIAIIICILVVAFM* |
| Ga0098041_10165181 | 3300006928 | Marine | MKNFNQFVEELKSMEGLERFNWYVLKPIALIICILVVAFM* |
| Ga0075463_101071034 | 3300007236 | Aqueous | DVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0070752_11309793 | 3300007345 | Aqueous | IQWEVDVMKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFMGGNN* |
| Ga0070753_12339072 | 3300007346 | Aqueous | MKSFNEFVEEVKSMEGLERFNWYVLKPIALIICILVVAFMGGNN* |
| Ga0099851_10512813 | 3300007538 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVITKSQWIVYQWITFMGGNN* |
| Ga0099851_12657492 | 3300007538 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFALM* |
| Ga0099849_12505393 | 3300007539 | Aqueous | WEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVITKSQWIVYQWITFMGGNN |
| Ga0099847_12497161 | 3300007540 | Aqueous | ARPLQWEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM* |
| Ga0099848_12113692 | 3300007541 | Aqueous | NQFVKELKSMEGLERFNWYVLKPIALMILILVFALM* |
| Ga0070751_13230041 | 3300007640 | Aqueous | WEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFMGGNN* |
| Ga0102954_11373512 | 3300007778 | Water | VDVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICTLVVSLM* |
| Ga0099850_11255811 | 3300007960 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMILILV |
| Ga0099850_12741713 | 3300007960 | Aqueous | EVDVMKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFMGGNN* |
| Ga0075480_105691412 | 3300008012 | Aqueous | NQFIKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0102963_11619221 | 3300009001 | Pond Water | VMKSFNQFVKELKSMEGLERFNWYVLKPIALLICILVVTKSQWIVYQWVTFMGGNN* |
| Ga0102963_13318113 | 3300009001 | Pond Water | VMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFMGGNN* |
| Ga0114918_105188661 | 3300009149 | Deep Subsurface | VMKRFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM* |
| Ga0115564_104404612 | 3300009505 | Pelagic Marine | VAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMIFILVVAFMGGNN* |
| Ga0098043_10075594 | 3300010148 | Marine | MNSFNQFVKELKSMEGLERFNWYVLKPTLLVLCLLIIIFV* |
| Ga0098056_12116202 | 3300010150 | Marine | MKSFNQFVEELKSMEGLERFNWYVLKPIALMILILVVAFM* |
| Ga0129348_11590291 | 3300010296 | Freshwater To Marine Saline Gradient | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILV |
| Ga0129348_12241933 | 3300010296 | Freshwater To Marine Saline Gradient | WEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0129345_10819743 | 3300010297 | Freshwater To Marine Saline Gradient | MKQFIKELKAMQGLEKFNWYVLKPIALLLCLYVVLTF* |
| Ga0129342_11540011 | 3300010299 | Freshwater To Marine Saline Gradient | RARPVQWEVDVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM* |
| Ga0129342_13006121 | 3300010299 | Freshwater To Marine Saline Gradient | VDVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVITKSQWIVYQWITFMGGNN* |
| Ga0136656_12423811 | 3300010318 | Freshwater To Marine Saline Gradient | RWEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVITKSQWIVYQWITFMGGNN* |
| Ga0129324_101101054 | 3300010368 | Freshwater To Marine Saline Gradient | LQWEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFMGGNN* |
| Ga0129327_102144714 | 3300013010 | Freshwater To Marine Saline Gradient | QWEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM* |
| Ga0129327_102356141 | 3300013010 | Freshwater To Marine Saline Gradient | WEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM* |
| Ga0180120_101710344 | 3300017697 | Freshwater To Marine Saline Gradient | VMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0180120_103719211 | 3300017697 | Freshwater To Marine Saline Gradient | WEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFM |
| Ga0181383_11779571 | 3300017720 | Seawater | MNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0187222_10642842 | 3300017734 | Seawater | VAVMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0181400_10485744 | 3300017752 | Seawater | CVGGLMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0181413_11976802 | 3300017765 | Seawater | SIRWEVAVMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0181425_10442144 | 3300017771 | Seawater | MESFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0181430_11452571 | 3300017772 | Seawater | FNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM |
| Ga0181394_11038941 | 3300017776 | Seawater | ILRSERSRSIRWEVAVMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0181380_10501354 | 3300017782 | Seawater | AVMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0181552_100661683 | 3300017824 | Salt Marsh | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFMGGNS |
| Ga0181607_103417292 | 3300017950 | Salt Marsh | MKQFIRELKAMQGLEKFNWYVLKPIALLLCLYVVLTF |
| Ga0181600_100385932 | 3300018036 | Salt Marsh | MKQFIKELKAMQGLEKFNWYVLKPIALLLCLYVVLTF |
| Ga0181561_101061654 | 3300018410 | Salt Marsh | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM |
| Ga0181561_101549801 | 3300018410 | Salt Marsh | MGGLLMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM |
| Ga0194024_10790293 | 3300019765 | Freshwater | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVA |
| Ga0194032_10214511 | 3300019938 | Freshwater | PLRWEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALVICILVVAFM |
| Ga0194032_10289372 | 3300019938 | Freshwater | MKSFNQFVKELKSMEGLERFNWYVLKPIALVICILV |
| Ga0181556_11046701 | 3300020176 | Salt Marsh | MGGLLMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFMG |
| Ga0211653_104404072 | 3300020421 | Marine | MKNFNQFVEELKSMEGLERFNWYVLKPIALIICILVVAFM |
| Ga0181557_11218381 | 3300020601 | Salt Marsh | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICIL |
| Ga0213865_100152515 | 3300021373 | Seawater | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0222718_104433761 | 3300021958 | Estuarine Water | EVAVMESFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0222716_102561933 | 3300021959 | Estuarine Water | RSRSIRWEVAVMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0222715_100232785 | 3300021960 | Estuarine Water | MNSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0224906_11718171 | 3300022074 | Seawater | NSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFM |
| Ga0196903_10015166 | 3300022169 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVALM |
| Ga0196891_10076934 | 3300022183 | Aqueous | MKSFNQFIKELKSMEGLERFNWYVLKPIALMILILVFALM |
| Ga0196905_10127419 | 3300022198 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFALM |
| Ga0196901_11895133 | 3300022200 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVITKSQWIVYQWITFMGGNN |
| Ga0255771_11327991 | 3300022900 | Salt Marsh | MGGLLMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAF |
| Ga0255779_10189807 | 3300022922 | Salt Marsh | MKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFMG |
| Ga0255753_10372453 | 3300022926 | Salt Marsh | MKSFNQFVKKLKSMEGLERFNWYVLKPIALVICILVVAFM |
| Ga0255769_102383661 | 3300022927 | Salt Marsh | VAVMKSFNQFVKELKSMEGLERFNWYVLKRIALVICILVVAFM |
| Ga0210003_11731521 | 3300024262 | Deep Subsurface | MKRFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM |
| Ga0208666_100251924 | 3300025102 | Marine | RPLRWEVAVMNSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0209535_10606234 | 3300025120 | Marine | MESFNQFVKELKSMEGLERFNWYVLKPIALMICILVVAFM |
| Ga0209535_10806905 | 3300025120 | Marine | AVMNSFNQFVKELKSMEGLERFNWYVLKPIALMILILVVAFMGGNS |
| Ga0209336_101921171 | 3300025137 | Marine | KELKSMEGLERFNWYVLKPIALMILILVVAFMGGNS |
| Ga0208428_10838301 | 3300025653 | Aqueous | RWEVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0208898_100493021 | 3300025671 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM |
| Ga0209653_10372974 | 3300025695 | Marine | MKSFNQFVKELKSMEGLERFNWYVLKPIALLICILVVTKSQWIVYQWVTFMGGNN |
| Ga0208899_10169499 | 3300025759 | Aqueous | MKSFNQFIKELKSMEGLERFNWYVLKPIALMICILVVALM |
| Ga0208899_11513764 | 3300025759 | Aqueous | EVDVMKSFNQFVKELKSMEGLERFNWYVLKPIALMILILVFAFM |
| Ga0209137_10041413 | 3300025767 | Marine | MKKFIKELKAMQGLEKFNWYVLKPIAVLLCLYVVLTF |
| Ga0208645_11120063 | 3300025853 | Aqueous | MKSFNQFVKELKSMEGLERFNWYVLKPIALIICILVVAFMGGNN |
| Ga0208645_12205291 | 3300025853 | Aqueous | EVAVMKSFNQFVKELKSMEGLERFNWYVLKPIALMICILVVALM |
| ⦗Top⦘ |