


| Basic Information | |
|---|---|
| Family ID | F090910 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GAFEGDGVLRFADSVSGSYNFITALPVSRLAVFLREQGVEV |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.63 % |
| % of genes near scaffold ends (potentially truncated) | 87.04 % |
| % of genes from short scaffolds (< 2000 bps) | 85.19 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.518 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 2.90% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF07478 | Dala_Dala_lig_C | 12.96 |
| PF00962 | A_deaminase | 4.63 |
| PF01261 | AP_endonuc_2 | 4.63 |
| PF00873 | ACR_tran | 3.70 |
| PF02545 | Maf | 3.70 |
| PF00903 | Glyoxalase | 3.70 |
| PF03544 | TonB_C | 2.78 |
| PF01569 | PAP2 | 1.85 |
| PF01494 | FAD_binding_3 | 1.85 |
| PF03477 | ATP-cone | 1.85 |
| PF14833 | NAD_binding_11 | 0.93 |
| PF01055 | Glyco_hydro_31 | 0.93 |
| PF04055 | Radical_SAM | 0.93 |
| PF14417 | MEDS | 0.93 |
| PF13286 | HD_assoc | 0.93 |
| PF01040 | UbiA | 0.93 |
| PF07238 | PilZ | 0.93 |
| PF01149 | Fapy_DNA_glyco | 0.93 |
| PF12706 | Lactamase_B_2 | 0.93 |
| PF03235 | DUF262 | 0.93 |
| PF00180 | Iso_dh | 0.93 |
| PF01850 | PIN | 0.93 |
| PF01957 | NfeD | 0.93 |
| PF00348 | polyprenyl_synt | 0.93 |
| PF11716 | MDMPI_N | 0.93 |
| PF00753 | Lactamase_B | 0.93 |
| PF12704 | MacB_PCD | 0.93 |
| PF00487 | FA_desaturase | 0.93 |
| PF02790 | COX2_TM | 0.93 |
| PF01507 | PAPS_reduct | 0.93 |
| PF12867 | DinB_2 | 0.93 |
| PF10518 | TAT_signal | 0.93 |
| PF00263 | Secretin | 0.93 |
| PF15902 | Sortilin-Vps10 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 4.63 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.70 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.70 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.85 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.85 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.85 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.93 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.93 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.93 |
| COG1501 | Alpha-glucosidase/xylosidase, GH31 family | Carbohydrate transport and metabolism [G] | 0.93 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.93 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.89 % |
| Unclassified | root | N/A | 11.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_101223983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300005332|Ga0066388_101170371 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300005334|Ga0068869_102105617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300005338|Ga0068868_101394819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300005439|Ga0070711_100923312 | Not Available | 746 | Open in IMG/M |
| 3300005545|Ga0070695_100445781 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005561|Ga0066699_10322932 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300005598|Ga0066706_11058243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 622 | Open in IMG/M |
| 3300005764|Ga0066903_101011249 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300006028|Ga0070717_10104977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2404 | Open in IMG/M |
| 3300006052|Ga0075029_100022142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3566 | Open in IMG/M |
| 3300006052|Ga0075029_100327524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300006163|Ga0070715_10692060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300006172|Ga0075018_10504726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300006794|Ga0066658_10015172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica → Salmonella enterica subsp. enterica | 2915 | Open in IMG/M |
| 3300006797|Ga0066659_10941830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300006800|Ga0066660_10227567 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300006804|Ga0079221_11104384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300009012|Ga0066710_102089002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300009093|Ga0105240_12694193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300009162|Ga0075423_12993010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300009792|Ga0126374_11054723 | Not Available | 641 | Open in IMG/M |
| 3300010048|Ga0126373_12053689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300010358|Ga0126370_10054164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2567 | Open in IMG/M |
| 3300010359|Ga0126376_13263072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010360|Ga0126372_11339956 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010361|Ga0126378_11536978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
| 3300010361|Ga0126378_13453469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010366|Ga0126379_10043934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3624 | Open in IMG/M |
| 3300010376|Ga0126381_100720157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300010376|Ga0126381_100764410 | Not Available | 1385 | Open in IMG/M |
| 3300010376|Ga0126381_103801483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300010379|Ga0136449_100685892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1722 | Open in IMG/M |
| 3300010398|Ga0126383_10027667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4451 | Open in IMG/M |
| 3300011120|Ga0150983_15854365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300011270|Ga0137391_10769117 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012189|Ga0137388_11012483 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 766 | Open in IMG/M |
| 3300012929|Ga0137404_11036244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300012930|Ga0137407_10283228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1511 | Open in IMG/M |
| 3300012948|Ga0126375_10036272 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300012971|Ga0126369_12233867 | Not Available | 634 | Open in IMG/M |
| 3300013296|Ga0157374_10649788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis → Asticcacaulis endophyticus | 1067 | Open in IMG/M |
| 3300013296|Ga0157374_12133644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300016270|Ga0182036_10739147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 798 | Open in IMG/M |
| 3300016294|Ga0182041_11703129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300016422|Ga0182039_10727470 | Not Available | 877 | Open in IMG/M |
| 3300017927|Ga0187824_10226483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300017933|Ga0187801_10018433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2352 | Open in IMG/M |
| 3300017933|Ga0187801_10510926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300017943|Ga0187819_10837898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 516 | Open in IMG/M |
| 3300018058|Ga0187766_11252827 | Not Available | 539 | Open in IMG/M |
| 3300018062|Ga0187784_10140061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1976 | Open in IMG/M |
| 3300018468|Ga0066662_11641184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300019877|Ga0193722_1048419 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300020170|Ga0179594_10176753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300020579|Ga0210407_10285040 | Not Available | 1289 | Open in IMG/M |
| 3300020581|Ga0210399_10288179 | Not Available | 1370 | Open in IMG/M |
| 3300020582|Ga0210395_10160129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1682 | Open in IMG/M |
| 3300021086|Ga0179596_10482719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300021170|Ga0210400_10555407 | Not Available | 947 | Open in IMG/M |
| 3300021171|Ga0210405_10016365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6102 | Open in IMG/M |
| 3300021171|Ga0210405_10226407 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300021178|Ga0210408_11493763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300021402|Ga0210385_10306653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300021406|Ga0210386_11545515 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021432|Ga0210384_10226372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1683 | Open in IMG/M |
| 3300021478|Ga0210402_10805007 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021479|Ga0210410_11289004 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300022531|Ga0242660_1182475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300025905|Ga0207685_10036093 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300025916|Ga0207663_10371281 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300025929|Ga0207664_11534636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300025933|Ga0207706_11556618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300025939|Ga0207665_11170925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 613 | Open in IMG/M |
| 3300026542|Ga0209805_1124846 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300026552|Ga0209577_10196439 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300027061|Ga0209729_1000465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2863 | Open in IMG/M |
| 3300027783|Ga0209448_10121262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300027842|Ga0209580_10581278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300027869|Ga0209579_10818479 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027910|Ga0209583_10602405 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan216 | 559 | Open in IMG/M |
| 3300027911|Ga0209698_10000417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 48900 | Open in IMG/M |
| 3300027986|Ga0209168_10006210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7598 | Open in IMG/M |
| 3300029636|Ga0222749_10069795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1594 | Open in IMG/M |
| 3300031231|Ga0170824_112037108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1160 | Open in IMG/M |
| 3300031708|Ga0310686_103537354 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300031718|Ga0307474_11369271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 558 | Open in IMG/M |
| 3300031719|Ga0306917_10308925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1223 | Open in IMG/M |
| 3300031720|Ga0307469_11698134 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031753|Ga0307477_10156598 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300031754|Ga0307475_10014509 | All Organisms → cellular organisms → Bacteria | 5362 | Open in IMG/M |
| 3300031777|Ga0318543_10401973 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031817|Ga0316046_101586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300031819|Ga0318568_10920537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031910|Ga0306923_10847789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1005 | Open in IMG/M |
| 3300031941|Ga0310912_11341840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300031942|Ga0310916_10990290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300031945|Ga0310913_11158196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031954|Ga0306926_10481617 | Not Available | 1527 | Open in IMG/M |
| 3300032052|Ga0318506_10181985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300032160|Ga0311301_10785724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300032174|Ga0307470_11764637 | Not Available | 523 | Open in IMG/M |
| 3300032180|Ga0307471_101781047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300032180|Ga0307471_102576233 | Not Available | 644 | Open in IMG/M |
| 3300032515|Ga0348332_10978714 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300032828|Ga0335080_10779025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 990 | Open in IMG/M |
| 3300032892|Ga0335081_10127700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3697 | Open in IMG/M |
| 3300033561|Ga0371490_1021289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2182 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.78% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031817 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1012239831 | 3300004091 | Bog Forest Soil | YVNKYDVLNYAGAFENDAVLLFADRIAGSYNLGTALPPSRLLVLLREQGVEV* |
| Ga0066388_1011703713 | 3300005332 | Tropical Forest Soil | FAGAFEDEAVLKFADRVSGAPNIGTAMPVSRLTFMLRELGAEI* |
| Ga0068869_1021056171 | 3300005334 | Miscanthus Rhizosphere | GAFEGDGVLRFAESVSGSFNFMTGVPVSRLAVFLREQGVAV* |
| Ga0068868_1013948192 | 3300005338 | Miscanthus Rhizosphere | VLSYAGAFESDVVLRFAERISGSYNFITALPVSVFVREQGVDT* |
| Ga0070711_1009233122 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GAFEDDAVLKFADRVSGSPNIGTAMPVSRLTLMLREVGVEI* |
| Ga0070695_1004457811 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSYAGAFESDVVLRFAERISGSHNFITALPVSVFVREQGVDT* |
| Ga0066699_103229321 | 3300005561 | Soil | LEREIQEYISKYAVLSYASVLESDAVLRFAERISGSYNFVTAIPVSRLIVFLREPAVEI* |
| Ga0066706_110582431 | 3300005598 | Soil | EDDAVLKFADRVSGSPNIGTAMPVSRLTLMLREQGVEV* |
| Ga0066903_1010112493 | 3300005764 | Tropical Forest Soil | GVLRFAEQISGSYNFIFALPVSRLIVFLRDQGVQV* |
| Ga0070717_101049771 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DVLSYAGAFENDAVMLFADRITGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0075029_1000221423 | 3300006052 | Watersheds | MDLSKYDVLNYAGAFEHDAILLFADQIRGSYNLGTALPPSRLLVLLREQGVEV* |
| Ga0075029_1003275241 | 3300006052 | Watersheds | AGAFENDAVLLFADRISGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0070715_106920602 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLHDCVRRYPVLRYAGALEGDSVLRFADSVSGSYNFVTAMPVSRLAVFLREQGVEV* |
| Ga0075018_105047261 | 3300006172 | Watersheds | LHDCVRRYPVLGYAGALEGDSVLRFADSVSGSYNFVTAMPVSRLAFFLREQGVEV* |
| Ga0066658_100151722 | 3300006794 | Soil | AVLRFAERISGSYNFVTAIPVSRLIVFLREPAVEI* |
| Ga0066659_109418302 | 3300006797 | Soil | GAFEGDGVLRFADSVSGSYNFITALPVSRLAVFLREQGVEV* |
| Ga0066660_102275672 | 3300006800 | Soil | VLSYAGVFESDAVLRFAERISGSYNFVTAIPVSRLIVFLREPAVEI* |
| Ga0079221_111043841 | 3300006804 | Agricultural Soil | NDAVLLFADRIAGSYNLGTALPPSRLIVLLREQGVQV* |
| Ga0066710_1020890021 | 3300009012 | Grasslands Soil | NYAGAFESDAVLFFADRISGSYNFVTALPVSRLIVFLRAQGVAV |
| Ga0105240_126941931 | 3300009093 | Corn Rhizosphere | VLRFAESVSGSFNFMTGVPVSRLAVFLREQGVAV* |
| Ga0075423_129930101 | 3300009162 | Populus Rhizosphere | FEGDGVLRFAESVSGSLNFMTGVPVSRLAVFLREQGVAV* |
| Ga0126374_110547232 | 3300009792 | Tropical Forest Soil | AYPVKNFAGAFEDDAVLKFADRVSGSPNIGTAMPVSRLTLMLRELGVDV* |
| Ga0126373_120536892 | 3300010048 | Tropical Forest Soil | YAGAFENDAVMLFADRIAGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0126370_100541641 | 3300010358 | Tropical Forest Soil | GVLRFAESVSGSFNFITGLPVSRLAVFLREQGVEV* |
| Ga0126376_132630722 | 3300010359 | Tropical Forest Soil | FESDAVLRFADRISGSYNFVTALPVSRLIVFLRAQGVAI* |
| Ga0126372_113399561 | 3300010360 | Tropical Forest Soil | RYDVLSYAGAFENDAVLLFADRIAGSYNLGTALPPSRLVVMLREQGVQV* |
| Ga0126378_115369781 | 3300010361 | Tropical Forest Soil | AVLKFAERIAGSYNFVTALPVSLLIVFLREQGAGL* |
| Ga0126378_134534692 | 3300010361 | Tropical Forest Soil | VLRCAGGFEGDGVLRFAERISGSYNFLTAVPVSRLIVFLREQGVAI* |
| Ga0126379_100439341 | 3300010366 | Tropical Forest Soil | ENDAVMLFAERISGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0126381_1007201572 | 3300010376 | Tropical Forest Soil | ENYINRYDVLRYAGAFENDAVLLFADRISGSYNLGTALPPSRLIVLLREQGVAV* |
| Ga0126381_1007644101 | 3300010376 | Tropical Forest Soil | FESDAVLRFAERISGSYNFMTALPVSRLIVFLRAQGVET* |
| Ga0126381_1038014832 | 3300010376 | Tropical Forest Soil | AFESDAALFFADRISGSYNFVTALPVSRLIVFLRAQGVEI* |
| Ga0136449_1006858921 | 3300010379 | Peatlands Soil | DAVLLFADRIAGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0126383_100276674 | 3300010398 | Tropical Forest Soil | AFENDAVLLFADRIAGSYNLGTALPPSKLIVLLREQGVEV* |
| Ga0150983_158543651 | 3300011120 | Forest Soil | LRFAGAFEGDGVLRFADSVSGSYNFITALPVSRLAVFLREQGVEV* |
| Ga0137391_107691172 | 3300011270 | Vadose Zone Soil | VLSYAGAFESDAVLRFAERISGSYNFVTALPVSRLIVFLRAQGIDI* |
| Ga0137388_110124831 | 3300012189 | Vadose Zone Soil | VRRYPVLRFAGAFEGDGVLRFADSVSGSYNFITALPVSRLAVFLREQGVEL* |
| Ga0137404_110362442 | 3300012929 | Vadose Zone Soil | YIFFRPFFDREIQLNISKYDVLNYAGAFENDAVLLFADRIAGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0137407_102832283 | 3300012930 | Vadose Zone Soil | SYAGAFESDAVLRFAERISGSYNFVTALPVSRLIVFLRAQGIDI* |
| Ga0126375_100362723 | 3300012948 | Tropical Forest Soil | MNFAGAFESDAVLRFADRISGSYNFVTALPVSRLIVFLRAQGVEI* |
| Ga0126369_122338671 | 3300012971 | Tropical Forest Soil | NYAVLNYAGAFESDAVLKFAETVSGAVNIGTALPVSRLTVMLRQQGVEV* |
| Ga0157374_106497881 | 3300013296 | Miscanthus Rhizosphere | RDYVMRYPVLQFAGAFEGDGVLRFAESVSGSFNFMTGVPVSRLAVFLREQGVAV* |
| Ga0157374_121336441 | 3300013296 | Miscanthus Rhizosphere | NDAVLLFADRITGSYNLGTALPPSRLIVLLREQGVEV* |
| Ga0182036_107391471 | 3300016270 | Soil | YDVLSYAGAFENDAVMLFAERISGSYNLGTALPPSRLIVLLREQGVEV |
| Ga0182041_117031292 | 3300016294 | Soil | LRYAGAIEGDGVLRFADAVSASYNFITAMPVSRLAVFLREQGVELDDSIRQ |
| Ga0182039_107274701 | 3300016422 | Soil | QYPVLSFAGAFESDAVLRFADRISGSYNFVTAIPISRLTMFLRQQGVEV |
| Ga0187824_102264832 | 3300017927 | Freshwater Sediment | FEDEAVALFSNRIAGSYNLGTALPPSRLIVLLREQGVEI |
| Ga0187801_100184331 | 3300017933 | Freshwater Sediment | YPVTNFAGAFEGDGVLRFAERVSGSYNFIAALPVSRLALFLRELGVAV |
| Ga0187801_105109261 | 3300017933 | Freshwater Sediment | GVLRFADSVSGSYNFITALPVSRLAVFLREQGIEV |
| Ga0187819_108378981 | 3300017943 | Freshwater Sediment | FEGDAVLKFAERITGSYNFVTALPVSRLIVFLRAQGVEI |
| Ga0187766_112528272 | 3300018058 | Tropical Peatland | NFAGAFENDAVYMFAERISGSYNIGTALPVSRLILFLREQGIEI |
| Ga0187784_101400611 | 3300018062 | Tropical Peatland | NFAGAFEGDGVLRFAERVSGSYNFITALPVSRLAVFLRDLGFEL |
| Ga0066662_116411843 | 3300018468 | Grasslands Soil | VLSYAGVFESDAVLRFAERISGSYNFVTAIPVSRLIVFLREPAVEI |
| Ga0193722_10484192 | 3300019877 | Soil | DYAGEFESDAVLKFAERVSGAVNIGTALPVSRLIVMLREQGVEV |
| Ga0179594_101767532 | 3300020170 | Vadose Zone Soil | LSYAGAFESDAVLRFAERISGSYNFVTALPVSRLIVFLRAQGIDI |
| Ga0210407_102850403 | 3300020579 | Soil | RSFRRHGVLRFADSVSGSYNFFTALPVSRLAVFLREQGVAV |
| Ga0210399_102881791 | 3300020581 | Soil | YAGAFESDAVLKFAEKVSGAVNIGTALPVSRLVTMLREQGVEV |
| Ga0210395_101601292 | 3300020582 | Soil | LVEREIREYVQKYAVLNYAGAFESDAVLKFADRVSGAVNIGTALPVSRLIGLLREQGVEV |
| Ga0179596_104827191 | 3300021086 | Vadose Zone Soil | GAFESDAVLRYAERISGSYNFVTALPVSRLTVFLREQGVEI |
| Ga0210400_105554071 | 3300021170 | Soil | LNYAGAFESDAVLKFADRVSGAVNIGTALPVSRLIGLLREQGVEV |
| Ga0210405_100163657 | 3300021171 | Soil | KYAVLNYAGAFESDAVLKFADRVSGAVNIGTALPVSRLIGLLREQGVEV |
| Ga0210405_102264071 | 3300021171 | Soil | PGLRFAGAFEGDGVLRFANSVSGSYNFVTAIPVSRLAVFLREQAVEV |
| Ga0210408_114937631 | 3300021178 | Soil | FESDAVLLFAERISGSYNFVTALPVSRLIVFLRAQGVTPETVD |
| Ga0210385_103066531 | 3300021402 | Soil | GAFENDAVYRFSERIEGSYNIGTAIPVGRLTLFLREMGVNV |
| Ga0210386_115455151 | 3300021406 | Soil | EIREYVQKYAVLNYAGAFESDAVLKFADRVSGAVNIGTALPVSRLIGLLREQGVEV |
| Ga0210384_102263723 | 3300021432 | Soil | KFAGAFEGDGVLRFADSVSGSYNFITALPVSRLAVFLREQGVAV |
| Ga0210402_108050072 | 3300021478 | Soil | GAFEGDGVLRFAESVSGSCNFVTGLPVSRLAVFLRELGVAV |
| Ga0210410_112890041 | 3300021479 | Soil | GFQGDGVLRFADSVSGSYNVITAMPVNRLAVFLREPGVEV |
| Ga0242660_11824752 | 3300022531 | Soil | YIGRYPVLRFAGAFEGDGVLRFADSVSGSYNFITALPVSRLAVFLREQGVEV |
| Ga0207685_100360931 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAFEDDAVLKFADRVSGSPNIGTAMPVSRLTLMLREVGVEI |
| Ga0207663_103712812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AYPVKTFAGAFEDDAVLKFADRVSGSPNIGTAMPVSRLTLMLREVGVEI |
| Ga0207664_115346362 | 3300025929 | Agricultural Soil | YIRAYPVLNYAGAFEEDAVRKFGERICGSYNIGTALPVSRLIVFLREQGVEV |
| Ga0207706_115566182 | 3300025933 | Corn Rhizosphere | YVMRYPVLQFAGAFEGDGVLRFAESVSGSFNFMTGVPVSRLAVFLREQGVAV |
| Ga0207665_111709252 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSFAGAFEGDGVLRFADSVSGSGSYNFITALPVSRLAVFLREQGVEV |
| Ga0209805_11248461 | 3300026542 | Soil | LEREIQEYISKYAVLSYASVLESDAVLRFAERISGSYNFVTAIPVSRLIVFLREPAVEI |
| Ga0209577_101964391 | 3300026552 | Soil | YAVLSYAGVLESDAVLRFAERISGSYNFVTAIPVSRLIVFLREPAVEI |
| Ga0209729_10004651 | 3300027061 | Forest Soil | LNYAGAFESDAVLFFADRISGSCNFVTALPVSRLIVF |
| Ga0209448_101212621 | 3300027783 | Bog Forest Soil | NDAVLLFADRIAGSYNLGTALPPSRLLVLLREQGVEV |
| Ga0209580_105812781 | 3300027842 | Surface Soil | GVLRFADSVSGSYNFITALPVSRLAVFLREQGVDV |
| Ga0209579_108184791 | 3300027869 | Surface Soil | LNYAGAFESDAVLKFGERVSGAVNIGTALPVSRLIGLLREQGVEV |
| Ga0209583_106024052 | 3300027910 | Watersheds | IEHYVGKYDVLSYAGAFENDAVLLFADRIAGSYNIGTALPPSRLIILLREQGVEI |
| Ga0209698_1000041715 | 3300027911 | Watersheds | MDLSKYDVLNYAGAFEHDAILLFADQIRGSYNLGTALPPSRLLVLLREQGVEV |
| Ga0209168_100062101 | 3300027986 | Surface Soil | GDGVARFADSVSGSYNFITALPVSRLAVFLREQGVEV |
| Ga0222749_100697953 | 3300029636 | Soil | AVLSYAGAFESDAVLRFAERISGSYNFVTALPVSRLIVFLRAQGVDI |
| Ga0170824_1120371081 | 3300031231 | Forest Soil | DYVRRYPVLRYAGALEGDSVLRFADSVSGSYNFITAMPVSRLAVILREQGVEV |
| Ga0310686_1035373541 | 3300031708 | Soil | FAGAFEGAGALRFADSVSGSYNFITAMPVSRLAVFLREQGVDA |
| Ga0307474_113692711 | 3300031718 | Hardwood Forest Soil | KYDVLSYAGAFENDAVMLFADRIAGSYNLGTALPPSRLIVLLRQQGVEV |
| Ga0306917_103089252 | 3300031719 | Soil | QDYIALYPVLSCAGGFEGDGVLRFAERISGSYNFLTAIPVSRLIVFLREQGVAI |
| Ga0307469_116981341 | 3300031720 | Hardwood Forest Soil | GAFESDAVLRFAERISGSYNFVTALPVSRLIVFLRAQGVDI |
| Ga0307477_101565982 | 3300031753 | Hardwood Forest Soil | DVLNYAGAFENDAVLLFADRIAGSYNVGTALPPSRLIVLLREQGVNI |
| Ga0307475_100145093 | 3300031754 | Hardwood Forest Soil | LSYAGAFESDAVLLFADRISGSYNFVTALPVSRLIVFLRAQGVSI |
| Ga0318543_104019732 | 3300031777 | Soil | AFESDALLFFADRICGSYNFVTALPVSRLIVFLRAQGIKI |
| Ga0316046_1015862 | 3300031817 | Soil | DGVLRFADSVSGSYNFITALPVSRLAIFLREQGVEV |
| Ga0318568_109205372 | 3300031819 | Soil | ARYPVQSCAGGFEGDGVLRFAERISGSYNFLTAIPVSRLIVFLREQGVAI |
| Ga0306923_108477891 | 3300031910 | Soil | LRYAGAIEGDGVLRFADAVSASYNFITAMPVSRLAVFLRAQGVEVQDDSIRQ |
| Ga0310912_113418401 | 3300031941 | Soil | LRYAGAIEGDGVLRFADAVSASYNFITAMPVSRLAVFLRAQGVEVPDDSIRQ |
| Ga0310916_109902901 | 3300031942 | Soil | DGVLRFAERISGSYNFLTAIPVSRLIVFLREQGVAI |
| Ga0310913_111581961 | 3300031945 | Soil | FESDAVLLFADRISGSYNFVTALPVSRLIVYLRSFSLPI |
| Ga0306926_104816173 | 3300031954 | Soil | LRYAGAIEGDGVLRFADAVSASYNFITAMPVSRLAVFLRAQGVEVPD |
| Ga0318506_101819852 | 3300032052 | Soil | VLNYAGAFESDAVLFFADRICGSYNFVTALPVSRLIVFLRAQGIKI |
| Ga0311301_107857242 | 3300032160 | Peatlands Soil | AGAFENDAVLLFADRIAGSYNLGTALPPSRLIVLLREQGVEV |
| Ga0307470_117646371 | 3300032174 | Hardwood Forest Soil | FRPLLEREIQNYIRAYPVKSFAAFEDDAVLKFADRVSGSPNIGTAMPVSRLTLMLREQGVDI |
| Ga0307471_1017810473 | 3300032180 | Hardwood Forest Soil | QYINKYDVLSYAGAFENDAVLLFAERISGSYNLGTALPPSRLIVLLREQGVEV |
| Ga0307471_1025762332 | 3300032180 | Hardwood Forest Soil | IQDYIGKYAVLNYAGAFESDAVLKFADRVSGAVNVGTALPVSRLTRMLREQGVEV |
| Ga0348332_109787145 | 3300032515 | Plant Litter | GDGVLRFADSVSGSYNFITALPVGRLAIFLREQGVEV |
| Ga0335080_107790251 | 3300032828 | Soil | AGAFEGDGVLRFAERVEGSFNFQTGVPVSRLIVMLREQGVEV |
| Ga0335081_101277001 | 3300032892 | Soil | YISKYDVLNYAGAFENDAVLLFADRIAGSYNLGTALPPSRLVVLLRAQGVDI |
| Ga0371490_10212892 | 3300033561 | Peat Soil | GAFEDDAVHMFAEHISGSYNIGTALPVRRLILFWREQGVNI |
| ⦗Top⦘ |