


| Basic Information | |
|---|---|
| Family ID | F090784 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AQDPFVLAAVALTVLLTGSLSVAGPVRRALHIDPANLLREQ |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.85 % |
| % of genes near scaffold ends (potentially truncated) | 93.52 % |
| % of genes from short scaffolds (< 2000 bps) | 86.11 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.593 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.889 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF13472 | Lipase_GDSL_2 | 3.70 |
| PF00903 | Glyoxalase | 1.85 |
| PF07045 | DUF1330 | 1.85 |
| PF00144 | Beta-lactamase | 1.85 |
| PF01590 | GAF | 1.85 |
| PF13673 | Acetyltransf_10 | 1.85 |
| PF12704 | MacB_PCD | 1.85 |
| PF00873 | ACR_tran | 0.93 |
| PF01127 | Sdh_cyt | 0.93 |
| PF05593 | RHS_repeat | 0.93 |
| PF01979 | Amidohydro_1 | 0.93 |
| PF03551 | PadR | 0.93 |
| PF00732 | GMC_oxred_N | 0.93 |
| PF00155 | Aminotran_1_2 | 0.93 |
| PF00578 | AhpC-TSA | 0.93 |
| PF02621 | VitK2_biosynth | 0.93 |
| PF13580 | SIS_2 | 0.93 |
| PF00535 | Glycos_transf_2 | 0.93 |
| PF03544 | TonB_C | 0.93 |
| PF08818 | DUF1801 | 0.93 |
| PF13466 | STAS_2 | 0.93 |
| PF01717 | Meth_synt_2 | 0.93 |
| PF01740 | STAS | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF01578 | Cytochrom_C_asm | 0.93 |
| PF12543 | DUF3738 | 0.93 |
| PF00430 | ATP-synt_B | 0.93 |
| PF03965 | Penicillinase_R | 0.93 |
| PF09848 | DUF2075 | 0.93 |
| PF13384 | HTH_23 | 0.93 |
| PF02321 | OEP | 0.93 |
| PF01022 | HTH_5 | 0.93 |
| PF00480 | ROK | 0.93 |
| PF13936 | HTH_38 | 0.93 |
| PF10282 | Lactonase | 0.93 |
| PF01610 | DDE_Tnp_ISL3 | 0.93 |
| PF00999 | Na_H_Exchanger | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF08241 | Methyltransf_11 | 0.93 |
| PF08240 | ADH_N | 0.93 |
| PF00116 | COX2 | 0.93 |
| PF10502 | Peptidase_S26 | 0.93 |
| PF10431 | ClpB_D2-small | 0.93 |
| PF00083 | Sugar_tr | 0.93 |
| PF13193 | AMP-binding_C | 0.93 |
| PF01370 | Epimerase | 0.93 |
| PF12867 | DinB_2 | 0.93 |
| PF10518 | TAT_signal | 0.93 |
| PF12833 | HTH_18 | 0.93 |
| PF01676 | Metalloenzyme | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.85 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.85 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.85 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.85 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.85 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.93 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.93 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.93 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.93 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.93 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
| COG2009 | Succinate dehydrogenase/fumarate reductase, cytochrome b subunit | Energy production and conversion [C] | 0.93 |
| COG2142 | Succinate dehydrogenase, hydrophobic anchor subunit | Energy production and conversion [C] | 0.93 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.93 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.93 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.93 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.93 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.93 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.93 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.96 % |
| Unclassified | root | N/A | 12.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10089014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1408 | Open in IMG/M |
| 3300001082|JGI12664J13189_1000466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5726 | Open in IMG/M |
| 3300003368|JGI26340J50214_10145933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 593 | Open in IMG/M |
| 3300004080|Ga0062385_11244999 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300004152|Ga0062386_101417535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 579 | Open in IMG/M |
| 3300005328|Ga0070676_11382962 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005466|Ga0070685_10555389 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005602|Ga0070762_10595374 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300006028|Ga0070717_10892942 | Not Available | 809 | Open in IMG/M |
| 3300006050|Ga0075028_101041487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300006052|Ga0075029_101151654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300006102|Ga0075015_100727689 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006162|Ga0075030_100413070 | Not Available | 1075 | Open in IMG/M |
| 3300006173|Ga0070716_100702281 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300007258|Ga0099793_10160204 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Anammoximicrobium → unclassified Candidatus Anammoximicrobium → Candidatus Anammoximicrobium sp. | 1069 | Open in IMG/M |
| 3300007265|Ga0099794_10263378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella pneumophila | 890 | Open in IMG/M |
| 3300009089|Ga0099828_10720593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300009089|Ga0099828_11771521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini | 543 | Open in IMG/M |
| 3300009094|Ga0111539_11001494 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300009400|Ga0116854_1048262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 602 | Open in IMG/M |
| 3300009500|Ga0116229_11524874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 528 | Open in IMG/M |
| 3300009698|Ga0116216_10356681 | Not Available | 889 | Open in IMG/M |
| 3300009701|Ga0116228_10240465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1283 | Open in IMG/M |
| 3300009701|Ga0116228_10607922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 742 | Open in IMG/M |
| 3300010341|Ga0074045_10257080 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300010376|Ga0126381_100665258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1487 | Open in IMG/M |
| 3300010376|Ga0126381_101219119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1087 | Open in IMG/M |
| 3300010391|Ga0136847_10901358 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300010937|Ga0137776_1298717 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300011120|Ga0150983_11907178 | Not Available | 708 | Open in IMG/M |
| 3300011120|Ga0150983_15825173 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300011269|Ga0137392_10030707 | All Organisms → cellular organisms → Bacteria | 3892 | Open in IMG/M |
| 3300011269|Ga0137392_11565382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300011270|Ga0137391_10611424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300011271|Ga0137393_10222900 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300012189|Ga0137388_10089274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2620 | Open in IMG/M |
| 3300012203|Ga0137399_10475434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300012203|Ga0137399_10740057 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012469|Ga0150984_105307457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1709 | Open in IMG/M |
| 3300012924|Ga0137413_10539906 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012927|Ga0137416_10510662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1036 | Open in IMG/M |
| 3300012944|Ga0137410_10073544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2482 | Open in IMG/M |
| 3300013100|Ga0157373_11426174 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300013296|Ga0157374_11621747 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300014164|Ga0181532_10072252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2208 | Open in IMG/M |
| 3300014200|Ga0181526_10115824 | Not Available | 1715 | Open in IMG/M |
| 3300014200|Ga0181526_10489700 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300014495|Ga0182015_10030007 | All Organisms → cellular organisms → Bacteria | 4217 | Open in IMG/M |
| 3300014969|Ga0157376_11613475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 683 | Open in IMG/M |
| 3300015264|Ga0137403_10374054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300016357|Ga0182032_10545899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 958 | Open in IMG/M |
| 3300017823|Ga0187818_10537166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 526 | Open in IMG/M |
| 3300017955|Ga0187817_10962776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300017988|Ga0181520_10612493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300018035|Ga0187875_10343639 | Not Available | 803 | Open in IMG/M |
| 3300018047|Ga0187859_10020324 | All Organisms → cellular organisms → Bacteria | 3682 | Open in IMG/M |
| 3300020170|Ga0179594_10214693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 722 | Open in IMG/M |
| 3300020581|Ga0210399_10757481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300021170|Ga0210400_10537238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300021178|Ga0210408_10852267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 711 | Open in IMG/M |
| 3300021405|Ga0210387_11167980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 669 | Open in IMG/M |
| 3300021560|Ga0126371_13856578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 505 | Open in IMG/M |
| 3300025929|Ga0207664_10240336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1577 | Open in IMG/M |
| 3300025981|Ga0207640_10094744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2077 | Open in IMG/M |
| 3300026557|Ga0179587_10162612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1397 | Open in IMG/M |
| 3300026557|Ga0179587_10462297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300027297|Ga0208241_1081426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli → Fimbriimonas ginsengisoli Gsoil 348 | 520 | Open in IMG/M |
| 3300027370|Ga0209010_1000751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9337 | Open in IMG/M |
| 3300027381|Ga0208983_1032189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300027502|Ga0209622_1074436 | Not Available | 621 | Open in IMG/M |
| 3300027559|Ga0209222_1003105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 3746 | Open in IMG/M |
| 3300027643|Ga0209076_1151794 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027681|Ga0208991_1232340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 527 | Open in IMG/M |
| 3300028673|Ga0257175_1114098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300028747|Ga0302219_10395243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 541 | Open in IMG/M |
| 3300028773|Ga0302234_10437751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 559 | Open in IMG/M |
| 3300028806|Ga0302221_10003282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9830 | Open in IMG/M |
| 3300028884|Ga0307308_10328050 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300029636|Ga0222749_10213415 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300029910|Ga0311369_10260816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1570 | Open in IMG/M |
| 3300029944|Ga0311352_10319001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1290 | Open in IMG/M |
| 3300029999|Ga0311339_10055956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5236 | Open in IMG/M |
| 3300030007|Ga0311338_10659609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1065 | Open in IMG/M |
| 3300030053|Ga0302177_10438825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 680 | Open in IMG/M |
| 3300030503|Ga0311370_11194456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 825 | Open in IMG/M |
| 3300030524|Ga0311357_11328681 | Not Available | 616 | Open in IMG/M |
| 3300030618|Ga0311354_10194491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2174 | Open in IMG/M |
| 3300030848|Ga0075388_11299785 | Not Available | 524 | Open in IMG/M |
| 3300031057|Ga0170834_104089468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 712 | Open in IMG/M |
| 3300031233|Ga0302307_10565655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 574 | Open in IMG/M |
| 3300031234|Ga0302325_10528674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1769 | Open in IMG/M |
| 3300031234|Ga0302325_10960735 | Not Available | 1175 | Open in IMG/M |
| 3300031236|Ga0302324_100825040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1287 | Open in IMG/M |
| 3300031239|Ga0265328_10254733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300031344|Ga0265316_10474068 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031681|Ga0318572_10788722 | Not Available | 565 | Open in IMG/M |
| 3300031708|Ga0310686_111170124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 750 | Open in IMG/M |
| 3300031708|Ga0310686_112646686 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300031708|Ga0310686_118266111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 596 | Open in IMG/M |
| 3300031720|Ga0307469_10377718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1201 | Open in IMG/M |
| 3300031724|Ga0318500_10434597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 655 | Open in IMG/M |
| 3300031744|Ga0306918_10137447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
| 3300031820|Ga0307473_10697868 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031897|Ga0318520_10697606 | Not Available | 634 | Open in IMG/M |
| 3300031910|Ga0306923_10124510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2929 | Open in IMG/M |
| 3300032001|Ga0306922_11925600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300032001|Ga0306922_11956251 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032180|Ga0307471_103105495 | Not Available | 589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.93% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100890141 | 3300000567 | Peatlands Soil | VLAAVALTMGLTGSLSVAGPVRRALRIDPANVLREQ* |
| JGI12664J13189_10004662 | 3300001082 | Forest Soil | VLTAVAFTTLVTGSLAVARPVRRALQVDPANVLGEQ* |
| JGI26340J50214_101459331 | 3300003368 | Bog Forest Soil | VLSVIVFQATAQDPFVIAAVALTILLTGSLSVAGPVRRALRIDPANVLRDQ* |
| Ga0062385_112449991 | 3300004080 | Bog Forest Soil | DPLVLISVALTMVVTGSISVAGPVRRVLHIDPARLLREQ* |
| Ga0062386_1014175351 | 3300004152 | Bog Forest Soil | GVAASRVLSHIVFQATAQDPIVIAAVAFTILLTGSLSVAGPVRRALRIDPANVLREQ* |
| Ga0070676_113829622 | 3300005328 | Miscanthus Rhizosphere | QDPFVIAAVVLTMALAGSLSVAGPVRRALHIDPAKLLREQ* |
| Ga0070685_105553891 | 3300005466 | Switchgrass Rhizosphere | IIVYQASAQDPFVLTAVVLTTVLTGLISVAGPVRRVLHVDPAKLLREQ* |
| Ga0070762_105953742 | 3300005602 | Soil | ASAQDPLVLAAVVGTTLLAGLLSIANPVRRALHLDPARLLREQ* |
| Ga0070717_108929423 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AQDPFVLGAVALTILLTGGLSVTGPVRKALNADRALLLREQ* |
| Ga0075028_1010414871 | 3300006050 | Watersheds | IVYQASAQDPFVLAAVALTVLLTGSLSVASPVRHVLHIDPANLLREQ* |
| Ga0075029_1011516541 | 3300006052 | Watersheds | IVFKAKAQDPLVLAAVAFTLLLSGLLSVAGPVSRASRIDPANVLREQ* |
| Ga0075015_1007276892 | 3300006102 | Watersheds | YQASAQDPFVLAAVACTTLLTGSLAVAGPVRRALQIDPANLLREE* |
| Ga0075030_1004130701 | 3300006162 | Watersheds | MPLRSHKIAFTTLWLSNCVTGSFAVAGPVRRALHIDPANLLREE* |
| Ga0070716_1007022811 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QDPFVLACVAFTTVLTGSLSVVGPVRRVLHADPATLLREQ* |
| Ga0099793_101602041 | 3300007258 | Vadose Zone Soil | HDPFVLAAVAFTTVLTGSLSVAGPVRRVLRADPATLLREQ* |
| Ga0099794_102633782 | 3300007265 | Vadose Zone Soil | MRSNLSTTGMLIVYQASAQDPFVLAAVVLTTVLTGSLSVAGPVRRVLHADPATLLREQ* |
| Ga0099828_107205931 | 3300009089 | Vadose Zone Soil | VLAAVALTLLLTGSLSVAGPVGRVLHVDPANLLREQ* |
| Ga0099828_117715211 | 3300009089 | Vadose Zone Soil | FVLAAVALTLLLAGSLSVAGPVSRVLHVDLATLLREQ* |
| Ga0111539_110014943 | 3300009094 | Populus Rhizosphere | QDPFVLTAVVLTTVLTGLISVAGPVRRVLHVDPAKLLREQ* |
| Ga0116854_10482622 | 3300009400 | Soil | ASAQDPVVLAAVAFTILLTGSLSVAGPVRRALNIDPANLLREQ* |
| Ga0116229_115248742 | 3300009500 | Host-Associated | VFQASAKDPVVLLAVALTILLTGALSIAGPVNRALHVDPANVLREQ* |
| Ga0116216_103566813 | 3300009698 | Peatlands Soil | LAAVALTLGITGSLSVACPVRRALRIDPANVLREQ* |
| Ga0116228_102404651 | 3300009701 | Host-Associated | VYRAYAQDPLVVAAVVMMMALTGALSVAGPVRRALSLDPAVLLREQ* |
| Ga0116228_106079221 | 3300009701 | Host-Associated | IVAVLFTMLLTGLLSVAGPVRRALHIDPASLLREQ* |
| Ga0074045_102570803 | 3300010341 | Bog Forest Soil | SAQDPFVLTAVALTVLLTGAPSVAGPVRRALQADPATLLREQ* |
| Ga0126381_1006652581 | 3300010376 | Tropical Forest Soil | QDPLVLAAVAFTILLSGSLAVAGPVRRALHIDPANVLREQ* |
| Ga0126381_1012191192 | 3300010376 | Tropical Forest Soil | PVVLAAVAFTILFSGLFAVAGPVRRALRVDPANVLREQ* |
| Ga0136847_109013581 | 3300010391 | Freshwater Sediment | LLSAIVYQASAQDPFVLAAVAFTTVLTGSLSVAGPVRRVLHVDPATLLREQ* |
| Ga0137776_12987172 | 3300010937 | Sediment | VLAAVVITMLITGSFAIAGPVRRALRADPAELLRQE* |
| Ga0150983_119071781 | 3300011120 | Forest Soil | SALDPLVLVAVVFTTLLAGLLSIANPVRRALHLDPARLLREQ* |
| Ga0150983_158251733 | 3300011120 | Forest Soil | VYQASAQDPFVLAAVAFTLLLTGSLSVAGPIRRVLHADPAILLREQ* |
| Ga0137392_100307071 | 3300011269 | Vadose Zone Soil | AIVYQASAQDPFVLAAVVFTLLLTGSMSVAGPVRRVLNIDPANLLREQ* |
| Ga0137392_115653821 | 3300011269 | Vadose Zone Soil | VYQASAHDPFVLAAVAFTTVLTGSLSVAGPVRRVLHADPATLLREQ* |
| Ga0137391_106114242 | 3300011270 | Vadose Zone Soil | VIVYQASAQDPFVLAAVLLTLLLTGSLSVAGPVRRVLHADPATLLREQ* |
| Ga0137393_102229001 | 3300011271 | Vadose Zone Soil | VLAAVAFTTVLTGSLSVAGPVKHVLHIDPANLLREQ* |
| Ga0137388_100892741 | 3300012189 | Vadose Zone Soil | PFVLAAVAFTTVLTASLSVAGPVRRVLHADPATLLREQ* |
| Ga0137399_104754341 | 3300012203 | Vadose Zone Soil | ASAQDPFVLAAVVFTTVLTGSLSVAGPVRRVLHADPATLLREQ* |
| Ga0137399_107400571 | 3300012203 | Vadose Zone Soil | PLVLAAVAFTTVLTGSLSVAGPVRRVLHADPATLLREQ* |
| Ga0150984_1053074573 | 3300012469 | Avena Fatua Rhizosphere | AIVYQASAQDPFVLACVGGTMVLTGLLSVAGPVRRALHIDPAKLLREQ* |
| Ga0137413_105399061 | 3300012924 | Vadose Zone Soil | AQDPFVLAAVAFTLLLTGAASVAGPVRRALHVDPANVLREQ* |
| Ga0137416_105106621 | 3300012927 | Vadose Zone Soil | AGILLGIAASKVLSAIVFQATAQDPIVLTAVALTILLTGALSVAGPVRRVLHVDPANVLRDL* |
| Ga0137410_100735444 | 3300012944 | Vadose Zone Soil | AQDPFVLAAVVLTTVLTGSLSVAGPVRRVLHADPATLLREQ* |
| Ga0157373_114261741 | 3300013100 | Corn Rhizosphere | DPVVLIAVAFTVLVTGSLAVAGPVRRALHVDPANLLREE* |
| Ga0157374_116217472 | 3300013296 | Miscanthus Rhizosphere | YQATAQDPVVLIAVAFTVLVTGSLAVAGPVRRALHVDPANLLREE* |
| Ga0181532_100722523 | 3300014164 | Bog | LGVAASRVLSVIVFQATAQDPFVIAAVAFTILLTGSLSVAGPVRRSLRIDPANVLREQ* |
| Ga0181526_101158242 | 3300014200 | Bog | FVLAAVALTLLLTGSLSVAAPVSRALHIDPANLLREQ* |
| Ga0181526_104897002 | 3300014200 | Bog | VIAAVAFTILLTGSLSVAGPVRRSLRIDPANVLREQ* |
| Ga0182015_100300071 | 3300014495 | Palsa | QASAQDPFVLAAVAFTMLLTASLSVAAPVRRALHVDPANLLREQ* |
| Ga0157376_116134752 | 3300014969 | Miscanthus Rhizosphere | PFVLAAVAFTVLMTGLLSVAGPVRRALHIDPANLLREQ* |
| Ga0137403_103740541 | 3300015264 | Vadose Zone Soil | ASKLLSAIVFQATSEDPLVLAAVISTTVLTGLLSVASPVKRVLHADPATLLREQ* |
| Ga0182032_105458991 | 3300016357 | Soil | VFQATAQDPFVLTAVAVTLLVSGLLSVAGPVRRALRVDPAKVLREQ |
| Ga0187818_105371663 | 3300017823 | Freshwater Sediment | AQDPFVLAAVLCTVLLTGSLSVAGPVRRALQIDPANLLREE |
| Ga0187817_109627762 | 3300017955 | Freshwater Sediment | IVYQASAQDPFVLAAVACTVMLTGSLSVAGPVRRALQIDPANLLREE |
| Ga0181520_106124933 | 3300017988 | Bog | SAQDPIVLSSVAITMALTGSLSVAGPVRRALRIDPARLLREQ |
| Ga0187875_103436393 | 3300018035 | Peatland | VYQASAQDPFVLGAVALTVLVTGSLSVAGPVRRALRIDPANVLREQ |
| Ga0187859_100203241 | 3300018047 | Peatland | IVYQASAQDPVVLLAVAFTVLLTGSLSVIGPVRRALRIDPAKVLREQ |
| Ga0179594_102146931 | 3300020170 | Vadose Zone Soil | LLSAIVYQASAQDPVVLTAVAFTTIVTATLSVAGPVRRVLHADPATLLREQ |
| Ga0210399_107574812 | 3300020581 | Soil | YQASAQDPFVLAAVALTLLLTGSLSVAGPVRRVLHADPATLLREQ |
| Ga0210400_105372381 | 3300021170 | Soil | PFVLAAVAFTMLLTGLLSVVNPIRRALQIDPASILRDQ |
| Ga0210408_108522672 | 3300021178 | Soil | SAIVYQASAQDPFVLAAVVLTTVLTGSLSVAGPVRRVLHADPATLLREQ |
| Ga0210387_111679801 | 3300021405 | Soil | AIVYQASAQDPFVLATVAFTVLLTGSLSVAGPVKRVLHIDPANVLREQ |
| Ga0126371_138565781 | 3300021560 | Tropical Forest Soil | DPFVLTAVAFTLLVSALLSVAGPVRRALRVDPANVLREQ |
| Ga0207664_102403361 | 3300025929 | Agricultural Soil | PLVLVAVALTVLVTGFLAVARPVRRALLVDPARLLREE |
| Ga0207640_100947443 | 3300025981 | Corn Rhizosphere | VYQATAQDPVVLIAVAFTVLVTGSLAVAGPVRRALHVDPANLLREE |
| Ga0179587_101626121 | 3300026557 | Vadose Zone Soil | VLLAVAFTLLLTGSLSVAGPVRRALRIDPASVLREQ |
| Ga0179587_104622971 | 3300026557 | Vadose Zone Soil | FQATAQDPIVLTAVALTILLTGALSVAGPVRRVLHVDPANVLRDQ |
| Ga0208241_10814261 | 3300027297 | Forest Soil | AAGSATRGVYQASAQDPFVLAAVVLTTVLTGSLSVAGPVKRVLNADPATLLREQ |
| Ga0209010_10007515 | 3300027370 | Forest Soil | VLTAVAFTTLVTGSLAVARPVRRALQVDPANVLGEQ |
| Ga0208983_10321891 | 3300027381 | Forest Soil | YQATAQDPFVLAAVALTLLLTGSLSVAGPVRRVLHADPANLLREQ |
| Ga0209622_10744361 | 3300027502 | Forest Soil | PFVLGAVAVTILLTGGLSVTGPVRKALNADPALLLREQ |
| Ga0209222_10031057 | 3300027559 | Forest Soil | VLAAVALTLLLTGSLSVAGPVRRALHIDPANVLREE |
| Ga0209076_11517941 | 3300027643 | Vadose Zone Soil | YQATAQDPFVLAAVAFTTLLTGSLSVAGPVRRVLHADPATLLREQ |
| Ga0208991_12323401 | 3300027681 | Forest Soil | DPFVLAAVALTLLLTGSLSVAGPVRRVLHADPANLLREQ |
| Ga0257175_11140982 | 3300028673 | Soil | QDPFVLAAVACTTLLTGLLAVAGPVRRALRIDPANVLREQ |
| Ga0302219_103952432 | 3300028747 | Palsa | AIVYQASAQDPFVLAAVAFTMLLTASLSVAAPVRRALHVDPANLLREQ |
| Ga0302234_104377511 | 3300028773 | Palsa | FVLTAVAFTMVLTGSLSVAGPVRRALHIDPAHLLREQ |
| Ga0302221_100032828 | 3300028806 | Palsa | AVVFQASAHDPFVLAAVVFTMLLTGLLSVAGPVRRVLHVDPAKLLREQ |
| Ga0307308_103280502 | 3300028884 | Soil | AQDPFVLAAVALTVLLTGSLSVAGPVRRALHIDPANLLREQ |
| Ga0222749_102134151 | 3300029636 | Soil | FILAAVAFTVLLTGSLSVAGPVRRVLHVDPANLLREQ |
| Ga0311369_102608161 | 3300029910 | Palsa | PTTPSRRRSRSSASAPLVLAAVALTGSLSVAGPVRWALRIDPANLLREE |
| Ga0311352_103190011 | 3300029944 | Palsa | VFQASAQDPLVLLAVSLTILFTGCLSVAGPVRRALRLDPASVLREQ |
| Ga0311339_100559565 | 3300029999 | Palsa | VLASVALTMLLTAPLSVAGPVRRALHIDPANLLREQ |
| Ga0311338_106596091 | 3300030007 | Palsa | VYQASAQDPLVLVAVAFTMALTATLSIAGPVRRALHIDPAHLLREQ |
| Ga0302177_104388252 | 3300030053 | Palsa | QDPLVLLAVSLTILFTGCLSVAGPVRRALRLDPASVLREQ |
| Ga0311370_111944561 | 3300030503 | Palsa | SAQDPFVLASVALTMLLTAPLSVAGPVRRALHIDPANLLREQ |
| Ga0311357_113286812 | 3300030524 | Palsa | QASAEDPFVLIAVALTMALTAALSVASPVNRALHIDPANVLREQ |
| Ga0311354_101944911 | 3300030618 | Palsa | IVFQATAQDPIVLTAVALTILLTGALSVAGPVRRALHVDPANVLREQ |
| Ga0075388_112997851 | 3300030848 | Soil | LAAVVFTLLLTGTLSVASPVRRALYIDPANLLREQ |
| Ga0170834_1040894681 | 3300031057 | Forest Soil | LSAIVYQASAQDPFVLAAVVFTLLLTGTLSVAGPVRRVLYIDPANLLREQ |
| Ga0302307_105656551 | 3300031233 | Palsa | SAIVYQASAQDPIVLAAVSFTMALSASFSVAGPVRRALRIDQAHLLREQ |
| Ga0302325_105286741 | 3300031234 | Palsa | ASRILSAIVFQATAQDPFVLTAVAFTILLTGALSVAGPVRRALHVDPALLLREQ |
| Ga0302325_109607351 | 3300031234 | Palsa | PFVLAAVAFTMVLTGLLSVAAPVRRALHIDPAHLLREQ |
| Ga0302324_1008250401 | 3300031236 | Palsa | IVYQASAEDPFVLIAVALTMALTAALSVASPVNRALHIDPANVLREQ |
| Ga0265328_102547332 | 3300031239 | Rhizosphere | SAQDPFVLAAVAFTMMLAGSLSVAGPVRRALRADPANLLREQ |
| Ga0265316_104740681 | 3300031344 | Rhizosphere | TAQDPFVLAAVALTILLTGSLSVAGPVRRALHIDPANVLREQ |
| Ga0318572_107887222 | 3300031681 | Soil | AQDPVVLGAVAFTILLSGLLAVAGPVRRAVRVDPANVLREQ |
| Ga0310686_1111701242 | 3300031708 | Soil | LAAVALTMVLTGTLSVAGPVRRALHIDPAHLLREQ |
| Ga0310686_1126466864 | 3300031708 | Soil | FVLAAVALTMALTGSISVAGPVRRVLHVDPANLLREQ |
| Ga0310686_1182661112 | 3300031708 | Soil | SAQDPLVLLAVSLTILFTGCLSVAGPVRRALRLDPASVLREQ |
| Ga0307469_103777182 | 3300031720 | Hardwood Forest Soil | VLGAVALTVLITGSLSVAGPVRRALHIDPANLLREQ |
| Ga0318500_104345972 | 3300031724 | Soil | AQDPLVLAAVAFTILLSGSLAVAGPVRRALHIDPANVLREQ |
| Ga0306918_101374471 | 3300031744 | Soil | VLTAVALTILLSGLLAVAGPVRRALHIDPANVLREQ |
| Ga0307473_106978682 | 3300031820 | Hardwood Forest Soil | LSAIVYQASAKDPFVLAAVALTLLLTGSLSVAGPVRRVLHVDPANLLREQ |
| Ga0318520_106976061 | 3300031897 | Soil | LSHVVFQATAQDPFVLTAVAVTLLVSGLLSVAGPVRRALRVDPAKVLREQ |
| Ga0306923_101245106 | 3300031910 | Soil | DPIVLTAVASTILLTGALSVAGPVRRALHVDPAHFLREL |
| Ga0306922_119256001 | 3300032001 | Soil | LLGVAASRVLSHIVFQATAQDPVVLAAVAFTILFSGLFAVAGPVRRALRVDPANVLREQ |
| Ga0306922_119562511 | 3300032001 | Soil | LVLGAVMFTMALTGLLSVAGPVKRALHIDPAELLREQ |
| Ga0307471_1031054952 | 3300032180 | Hardwood Forest Soil | IVFQATAQDPLVLAAVAFTILLSGLLAVAGPVRRALHVDPANVLREQ |
| ⦗Top⦘ |