


| Basic Information | |
|---|---|
| Family ID | F090757 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MREVVAKRIMEMAQRGVQDREALVADALRFITANYEQPSKLAK |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.85 % |
| % of genes near scaffold ends (potentially truncated) | 64.81 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF01520 | Amidase_3 | 28.70 |
| PF01522 | Polysacc_deac_1 | 2.78 |
| PF12599 | DUF3768 | 0.93 |
| PF13701 | DDE_Tnp_1_4 | 0.93 |
| PF00196 | GerE | 0.93 |
| PF04392 | ABC_sub_bind | 0.93 |
| PF01875 | Memo | 0.93 |
| PF03592 | Terminase_2 | 0.93 |
| PF00872 | Transposase_mut | 0.93 |
| PF01425 | Amidase | 0.93 |
| PF13751 | DDE_Tnp_1_6 | 0.93 |
| PF01464 | SLT | 0.93 |
| PF03466 | LysR_substrate | 0.93 |
| PF14237 | GYF_2 | 0.93 |
| PF03734 | YkuD | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 28.70 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.93 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.93 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.93 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.22 % |
| Unclassified | root | N/A | 27.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100998644 | Not Available | 721 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101482758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300005437|Ga0070710_10905197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300005546|Ga0070696_101612982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300005610|Ga0070763_10265170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300005610|Ga0070763_10771028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300005764|Ga0066903_101831935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300005764|Ga0066903_108022885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300006028|Ga0070717_11212144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300006028|Ga0070717_11995541 | Not Available | 523 | Open in IMG/M |
| 3300006052|Ga0075029_100046535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2503 | Open in IMG/M |
| 3300006052|Ga0075029_100165834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1365 | Open in IMG/M |
| 3300006052|Ga0075029_100365928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300006057|Ga0075026_101053956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300006059|Ga0075017_100556703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300006086|Ga0075019_10022554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3519 | Open in IMG/M |
| 3300006086|Ga0075019_11100831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300006102|Ga0075015_100081678 | Not Available | 1594 | Open in IMG/M |
| 3300006174|Ga0075014_100073333 | Not Available | 1534 | Open in IMG/M |
| 3300006174|Ga0075014_100369101 | Not Available | 775 | Open in IMG/M |
| 3300006174|Ga0075014_100388896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300006174|Ga0075014_100896490 | Not Available | 531 | Open in IMG/M |
| 3300006904|Ga0075424_102851475 | Not Available | 503 | Open in IMG/M |
| 3300007982|Ga0102924_1168432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 988 | Open in IMG/M |
| 3300009520|Ga0116214_1275732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300009521|Ga0116222_1079025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300009522|Ga0116218_1054936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1807 | Open in IMG/M |
| 3300009522|Ga0116218_1464815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300009683|Ga0116224_10278990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300009700|Ga0116217_10098253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2008 | Open in IMG/M |
| 3300009792|Ga0126374_11608748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300009824|Ga0116219_10762944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300010361|Ga0126378_13309886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300010366|Ga0126379_13866133 | Not Available | 502 | Open in IMG/M |
| 3300010373|Ga0134128_10978925 | Not Available | 935 | Open in IMG/M |
| 3300010373|Ga0134128_11556619 | Not Available | 728 | Open in IMG/M |
| 3300010375|Ga0105239_11249332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300010376|Ga0126381_103302327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300010379|Ga0136449_100433741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2314 | Open in IMG/M |
| 3300010396|Ga0134126_12736923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300010398|Ga0126383_11189877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300010398|Ga0126383_12879278 | Not Available | 562 | Open in IMG/M |
| 3300010399|Ga0134127_12001252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300012955|Ga0164298_10857400 | Not Available | 656 | Open in IMG/M |
| 3300012957|Ga0164303_10441021 | Not Available | 817 | Open in IMG/M |
| 3300012960|Ga0164301_11367501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300012961|Ga0164302_10663008 | Not Available | 767 | Open in IMG/M |
| 3300012984|Ga0164309_10183086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1426 | Open in IMG/M |
| 3300012988|Ga0164306_11640319 | Not Available | 556 | Open in IMG/M |
| 3300015372|Ga0132256_101663507 | Not Available | 748 | Open in IMG/M |
| 3300016270|Ga0182036_11045142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300016387|Ga0182040_10914071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter marinus | 728 | Open in IMG/M |
| 3300016387|Ga0182040_11618790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300016422|Ga0182039_11408057 | Not Available | 633 | Open in IMG/M |
| 3300016445|Ga0182038_11583137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300017932|Ga0187814_10229633 | Not Available | 701 | Open in IMG/M |
| 3300017933|Ga0187801_10019563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2291 | Open in IMG/M |
| 3300017942|Ga0187808_10079608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1412 | Open in IMG/M |
| 3300017970|Ga0187783_10052623 | Not Available | 3003 | Open in IMG/M |
| 3300018001|Ga0187815_10502916 | Not Available | 519 | Open in IMG/M |
| 3300018058|Ga0187766_10456586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300020579|Ga0210407_11216903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300020580|Ga0210403_11362230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 539 | Open in IMG/M |
| 3300020582|Ga0210395_10534689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 881 | Open in IMG/M |
| 3300020583|Ga0210401_11237978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300020583|Ga0210401_11454114 | Not Available | 543 | Open in IMG/M |
| 3300021088|Ga0210404_10381775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300021168|Ga0210406_10301188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300021168|Ga0210406_10791052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 723 | Open in IMG/M |
| 3300021171|Ga0210405_10335991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300021180|Ga0210396_10172172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1940 | Open in IMG/M |
| 3300021180|Ga0210396_10794791 | Not Available | 812 | Open in IMG/M |
| 3300021180|Ga0210396_11326006 | Not Available | 598 | Open in IMG/M |
| 3300021401|Ga0210393_10163518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1792 | Open in IMG/M |
| 3300021401|Ga0210393_10691483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
| 3300021403|Ga0210397_10426325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300021404|Ga0210389_11144035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300021406|Ga0210386_11493820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300021420|Ga0210394_10400235 | Not Available | 1208 | Open in IMG/M |
| 3300021420|Ga0210394_11570935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300021432|Ga0210384_10364161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300021477|Ga0210398_11612391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300021479|Ga0210410_10441700 | Not Available | 1164 | Open in IMG/M |
| 3300021559|Ga0210409_11245175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300022715|Ga0242678_1028683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300027783|Ga0209448_10136115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300027894|Ga0209068_10892693 | Not Available | 526 | Open in IMG/M |
| 3300027898|Ga0209067_10433017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300027911|Ga0209698_10826576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300028047|Ga0209526_10308452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300030494|Ga0310037_10171114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300031128|Ga0170823_12893789 | Not Available | 1172 | Open in IMG/M |
| 3300031708|Ga0310686_110781557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300031708|Ga0310686_113388770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300031708|Ga0310686_118380490 | Not Available | 917 | Open in IMG/M |
| 3300031718|Ga0307474_10119229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1980 | Open in IMG/M |
| 3300031718|Ga0307474_10321869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1193 | Open in IMG/M |
| 3300031719|Ga0306917_10360752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1131 | Open in IMG/M |
| 3300031719|Ga0306917_10549496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300031798|Ga0318523_10692396 | Not Available | 500 | Open in IMG/M |
| 3300031946|Ga0310910_10165633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1700 | Open in IMG/M |
| 3300031946|Ga0310910_10519087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300031954|Ga0306926_10114338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3321 | Open in IMG/M |
| 3300032001|Ga0306922_10822572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300032076|Ga0306924_11062485 | Not Available | 885 | Open in IMG/M |
| 3300032160|Ga0311301_10026163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 15684 | Open in IMG/M |
| 3300033289|Ga0310914_10417060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300033289|Ga0310914_11020137 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 13.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1009986441 | 3300002245 | Forest Soil | RAMREVVAKRIFEMARNGVEDREALVTNALKFVAANYEPSRQRAK* |
| JGIcombinedJ26739_1014827581 | 3300002245 | Forest Soil | MEMAQRGVQDREALVADALRFVTANYEEPSKQTS* |
| Ga0070710_109051972 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AYSRVMREVVAKRIMEMAQCGVEDREALVEDALRFIAANYEQPSKLAK* |
| Ga0070696_1016129822 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKRIMEMAQRGVEDREALVADALGFIAANYEQPQPHKLAK* |
| Ga0070763_102651701 | 3300005610 | Soil | REVVAKRITEMAQPGVQDRETLVEDAARFVTANYERPSD* |
| Ga0070763_107710282 | 3300005610 | Soil | MREVVAKRIMEMAQRGVQDRKALAADALRFVAANYDQPSEIAK* |
| Ga0066903_1018319351 | 3300005764 | Tropical Forest Soil | AMREVVAKRIIEMAQRGIQDREALVEDVMRFVTTNYERPSN* |
| Ga0066903_1080228851 | 3300005764 | Tropical Forest Soil | KRIMEMAQRGVQDRAALVIDAIQFIAANYEQPSELAT* |
| Ga0070717_112121442 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVAKRIIEMAQRGVEGREALVADALRFIAANYEQQQPRKLAN* |
| Ga0070717_119955411 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREVVAKRIMEMAQHGVQDREALVADALRFVAANYDQPSKLAK* |
| Ga0075029_1000465353 | 3300006052 | Watersheds | MREVVAKRIMEMAQRGVQDREALVADALRFVTANYEEPSKQTS* |
| Ga0075029_1001658342 | 3300006052 | Watersheds | MGERVMREVVAKRIMEMAERGVQDREVLVTDAIRFIAANYQQPSTLAK* |
| Ga0075029_1003659282 | 3300006052 | Watersheds | EVVAKRIMEMAQRGVQDREELVADALRFVTANYEEPSKLTS* |
| Ga0075026_1010539562 | 3300006057 | Watersheds | RPAYSRVMREVVAKRIMEMAQRGVQDREALVADALRFIAANYEESSKLTN* |
| Ga0075017_1005567032 | 3300006059 | Watersheds | VVAKRIMEMAQRGVEDRQVLVEDAVRFVTTNYEGPSKLTN* |
| Ga0075019_100225546 | 3300006086 | Watersheds | MREVVAKRIMEMAERGVQDREVLVTDAIRFIAANYQQPSTLAK* |
| Ga0075019_111008311 | 3300006086 | Watersheds | IMEMAQRGVQDREALVADALRFITAAYEEPNKLTS* |
| Ga0075015_1000816783 | 3300006102 | Watersheds | RPAYSRVMREVVAKRIMELAQRGERDRETLVEDALRFVVANYEKPALR* |
| Ga0075014_1000733334 | 3300006174 | Watersheds | MREVVAKRIIEMAQRGVQDRETLVEDAVRFVTTNYERPSN* |
| Ga0075014_1003691011 | 3300006174 | Watersheds | MREVVAKRIIEMAQRGVQDRETLVEDAVRFVTTNYERRSN* |
| Ga0075014_1003888961 | 3300006174 | Watersheds | VVAKRIMEMAQRGVQDREELVADALRFVTANYEEPSKLTS* |
| Ga0075014_1008964902 | 3300006174 | Watersheds | MEMAQRGVEDREALVTDALRFIAANYEKPSKLAK* |
| Ga0075424_1028514751 | 3300006904 | Populus Rhizosphere | VVAKRIMEMAQRGVKDREALVTDAIQFIATNYEQPSELAT* |
| Ga0102924_11684322 | 3300007982 | Iron-Sulfur Acid Spring | VAKRIMEMAQRGVQDRDALVADALRFVAANYEEPSKLAK* |
| Ga0116214_12757322 | 3300009520 | Peatlands Soil | VVAKRIMEMAQRGVEDREALVEDALRFITANYEQPSKLAK* |
| Ga0116222_10790252 | 3300009521 | Peatlands Soil | MREVVAKRIMEMAQRGVQDREALVADALRFITANYEQPSKLAK* |
| Ga0116218_10549362 | 3300009522 | Peatlands Soil | MREVVAKRIMEMAQRGVQDRDALVADDLRFVSANYEEPSKLTS* |
| Ga0116218_14648151 | 3300009522 | Peatlands Soil | KRIMEMAQRGVQDREALVADALRFIAANYEQPNKRQNNG* |
| Ga0116224_102789902 | 3300009683 | Peatlands Soil | ARPAYSRVMREVVAKRIMEMAQRGVQDRQALVEDAVRFISANYERPSKLTN* |
| Ga0116217_100982532 | 3300009700 | Peatlands Soil | MREVVAKRIMEMAQRGIEDREALVADALHFVTTNYEEPSKLTN* |
| Ga0126374_116087482 | 3300009792 | Tropical Forest Soil | MREVVAKRIMQMAQRGVQDREALVADALRFVAANYEEPSKLEK* |
| Ga0116219_107629442 | 3300009824 | Peatlands Soil | EVVAKRIMEMAQRGVQDRDALVADDLRFVSANYEEPSKLTS* |
| Ga0126378_133098862 | 3300010361 | Tropical Forest Soil | VMREVVAKRIIEMAQRGVENREALVADALRFITANYEQPEPCKLAK* |
| Ga0126379_138661331 | 3300010366 | Tropical Forest Soil | RIMEMAQRGVQDREALVADALRFVTTNYEESSKLTN* |
| Ga0134128_109789251 | 3300010373 | Terrestrial Soil | MREVVAKRIIEMAQRGVEDRDALVADVLRFVTTNYEGPSKPTN* |
| Ga0134128_115566191 | 3300010373 | Terrestrial Soil | VVAKRIMEMAQRGVKDREALVTDAIQFIATNYEQPSE |
| Ga0105239_112493322 | 3300010375 | Corn Rhizosphere | MREVVAKRIIDMAQRGVEGRETLVADALRFIAENYEQPSELAK* |
| Ga0126381_1033023271 | 3300010376 | Tropical Forest Soil | AKRIMEMAQRGVQDREVLVVDALRFVAANYEEPSKLAK* |
| Ga0136449_1004337411 | 3300010379 | Peatlands Soil | MREVVAKRIMEMAQRGVQDHKTRVEDAVRFVTANYEEPSKLTN* |
| Ga0134126_127369231 | 3300010396 | Terrestrial Soil | RIMEMAQCGVKDRETLVTDAIQFIAANYEQPSELAT* |
| Ga0126383_111898772 | 3300010398 | Tropical Forest Soil | MREVVAKRIMGMAQRGVQDHEALVEDAVRFVTTNYDGPSKLTN* |
| Ga0126383_128792781 | 3300010398 | Tropical Forest Soil | MREVVAKRIIEMAQRGIQDREALVEDVMRFVTTNYERPSN* |
| Ga0134127_120012522 | 3300010399 | Terrestrial Soil | MREVVAKRIIELAQRGVEDRGALVADALGFIAANYEQPQPHKLAK* |
| Ga0164298_108574001 | 3300012955 | Soil | MREVVAKRVIEMAQRGVEDREALVVDALQFIAANYDQPQPRQLAK* |
| Ga0164303_104410211 | 3300012957 | Soil | MREAVAKRIMEMAQRGVQDREALVADALRFIAANYEQPSKLAK* |
| Ga0164301_113675011 | 3300012960 | Soil | KRIMEMAQRGVENREALVTDALRFIAANYEQPSKLAN* |
| Ga0164302_106630081 | 3300012961 | Soil | MREAVAKRIMEMAQRGVQDREALVADAVRFITASYEQPSKLAKITA* |
| Ga0164309_101830862 | 3300012984 | Soil | YSRVMREVVAKRIMEMAQRGVEDREALVEDALRFITANYEQPSKLAK* |
| Ga0164306_116403191 | 3300012988 | Soil | MREVVAKRIIELAQRGVEDRGALVADALGFIAANYEQPQPRKLAK* |
| Ga0132256_1016635071 | 3300015372 | Arabidopsis Rhizosphere | MREVIAKRIVEMAQCGMQDREALVADAIQFIAVNYEQPSELAT* |
| Ga0182036_110451421 | 3300016270 | Soil | MREVVAHRIIEMAQRGVQHREALVADALRFVAANYEEPSKLAK |
| Ga0182040_109140712 | 3300016387 | Soil | MREVVAKRIMEMAQRGVQDREALVADALRFVAANYEEPSKLTN |
| Ga0182040_116187901 | 3300016387 | Soil | VVAKRIMEMAQRGVQDREALVADVLRFVAANYEEPSKLAK |
| Ga0182039_114080572 | 3300016422 | Soil | MREVVAKRIIEIAQRGVQDRDTLVEDAVRFVTTNYEGPSKLTN |
| Ga0182038_115831372 | 3300016445 | Soil | AMREVVAKRIIEMAQRGVQDRDALVADALGFVAANYEEPGKLAK |
| Ga0187814_102296331 | 3300017932 | Freshwater Sediment | VAKRIMEMAQRGVQEREELVADALRFVTANYEEPSKLTS |
| Ga0187801_100195633 | 3300017933 | Freshwater Sediment | MREVVAKRIMEMAQRGVQDREELVADALRFVTANYEEPSKQTS |
| Ga0187808_100796081 | 3300017942 | Freshwater Sediment | MREVVAKRIMEMAQRGVQDREELVADALRFVTANYEEPSKLTS |
| Ga0187783_100526236 | 3300017970 | Tropical Peatland | MREVVAKRIMEMAQRGVQDREALVADALRFIAANYEERRILAK |
| Ga0187815_105029162 | 3300018001 | Freshwater Sediment | VAKRIMEMAQRGVQDRQALVEDAVRFISANYERPSKLTN |
| Ga0187766_104565862 | 3300018058 | Tropical Peatland | MREVVAKRIMEMAQRGVQDREALVADALRFVTANYEEPSKLTS |
| Ga0210407_112169032 | 3300020579 | Soil | RIMEMAQRGVEDREALVEDALRFITANYEQPSKLAK |
| Ga0210403_113622302 | 3300020580 | Soil | CHARVVAKRIMEMAQRGVEDREALVEDALRFITANYEQPSKLAK |
| Ga0210395_105346893 | 3300020582 | Soil | RPAYSRVMREVVAKHIMEMAQRGVEDREALVADALRFIAANYEERSKLAK |
| Ga0210401_112379781 | 3300020583 | Soil | VREVVAKRIMEMAQRGVQDREALVADTLRFVAANYDEPSKLAK |
| Ga0210401_114541141 | 3300020583 | Soil | RIIEMAPRGVRDREALVTDALQFIAANYEQPTKLTS |
| Ga0210404_103817751 | 3300021088 | Soil | YSRVMREVVAKRIMEMAQRGVEDREALVEDALRFITANYEQPSKLAK |
| Ga0210406_103011881 | 3300021168 | Soil | MREVVAKRIMEMAQRGVQGREALVADALRFITANYEQPSKLAK |
| Ga0210406_107910521 | 3300021168 | Soil | CQTHMEMAQRGVQDREALVADALRFVTANYEEPSKQTS |
| Ga0210405_103359913 | 3300021171 | Soil | REVVAKRIMEMAQRGVENREALVTDALRFVAANYEQPSKRR |
| Ga0210396_101721721 | 3300021180 | Soil | AMREVVAKRIIEMAQRGMEDREALVTGALQFIAANYEQSGQRVK |
| Ga0210396_107947911 | 3300021180 | Soil | LTRPAYSRVMREVVAKRIMEMAQCGVEDREALVEDALRFIAANYEQPSKLAK |
| Ga0210396_113260061 | 3300021180 | Soil | TRPAYSRVMREVVAKRIMELAQRGEQDRETLVEDALLFVVANYEDPALR |
| Ga0210393_101635182 | 3300021401 | Soil | MGERVMREVVAKRIMEMAERGVQDREVLVTDAIRFIAANYQQPSTLAK |
| Ga0210393_106914832 | 3300021401 | Soil | AKRIMEMAQRGVQDREALVADTLRFVAANYEEPSKLAK |
| Ga0210397_104263251 | 3300021403 | Soil | YLRVMREVVAKRIIELAQRGVQDRETLVEDAVRFVTANYERPSD |
| Ga0210389_111440351 | 3300021404 | Soil | VAKRIMEMAQRGVQDREALVADAVRFITANYEQPSKLAKITA |
| Ga0210386_114938201 | 3300021406 | Soil | AKRIMEMAQRGVQDREALVADALRFIAANYEERSKLAK |
| Ga0210394_104002351 | 3300021420 | Soil | VAKRIMEMAQRGVQDREALVADALRFIAANYEQPSKLAK |
| Ga0210394_115709351 | 3300021420 | Soil | SRLTRPAYSRVMREVVAKHIMEMAQRGVEDREALVADALRFIAANYEERSKLAK |
| Ga0210384_103641612 | 3300021432 | Soil | MREVVAKRIMEMAQRGVRDRQALVADALRFITANYEDSSKLTS |
| Ga0210398_116123911 | 3300021477 | Soil | VVAKRIMEMAQRGVQDRVALVADALRFIAANYEERSKLAK |
| Ga0210410_104417001 | 3300021479 | Soil | RIMEMVQRGVQGREALVADALRFITANYEQPSKLAK |
| Ga0210409_112451751 | 3300021559 | Soil | VMREVVAKRIMEMAQRGVQDRVALVADALRFIAANYEERSKLAK |
| Ga0242678_10286831 | 3300022715 | Soil | RVMREVVAKRITEMAQRGVQDREILVEDAVRFVTANYERPSD |
| Ga0209448_101361152 | 3300027783 | Bog Forest Soil | MREVVAKRIMEMAQRGVQDREALVADALRFVTANYEEPSKQTS |
| Ga0209068_108926931 | 3300027894 | Watersheds | MREVVAKRIIEMAQRGVQDRETLVEDAVRFVTTNYERRS |
| Ga0209067_104330172 | 3300027898 | Watersheds | AMREVVAKRIIEMAQRGVQDRETLVEDAVRFVTTNYERPSN |
| Ga0209698_108265762 | 3300027911 | Watersheds | LTRPAYSRVMREVVAKRIMEMAERGVQDREVLVTDAIRFIAANYQQPSTLAK |
| Ga0209526_103084522 | 3300028047 | Forest Soil | IMEMAQRGVENREALVTDALRFIAANYEQPSKLAN |
| Ga0310037_101711141 | 3300030494 | Peatlands Soil | IMEMAQRGVQDRDALVADDLRFVSANYEEPSKLTS |
| Ga0170823_128937891 | 3300031128 | Forest Soil | MREVVAKRIMEMAQRGVQDHDALVADALRFVTANYEEPSKQTS |
| Ga0310686_1107815572 | 3300031708 | Soil | PAYSRVMREVVAKRIMEMAQRGVEDREALVADALRFIAANYEQPTKLTS |
| Ga0310686_1133887701 | 3300031708 | Soil | RPAYSRVMREVVAKRIMEMAQRGVEDREALVEDALRFITANYEQPSKLAK |
| Ga0310686_1183804901 | 3300031708 | Soil | MREVVAKRIIEMAQRGVQDRETLVEDAVRFVTTNYERPSN |
| Ga0307474_101192293 | 3300031718 | Hardwood Forest Soil | AMREVVAKRIMEMAQRGVQDREALVADALRFVTANYEEPSKQTS |
| Ga0307474_103218692 | 3300031718 | Hardwood Forest Soil | MGERVVREVVAKRIMEMAERGVQDREVLVTDAIRFIAANYQQPSTLAK |
| Ga0306917_103607521 | 3300031719 | Soil | KRIIDMAQRGVQDREALVADALRFVTTNYEESSKLTN |
| Ga0306917_105494961 | 3300031719 | Soil | IIDMAQRGVEEREALVTDALRFIAANYEQPGKLVK |
| Ga0318523_106923962 | 3300031798 | Soil | MREVVAKRIMEMAQRGVQDREALVADALRFVTTNYEESSKLTN |
| Ga0310910_101656331 | 3300031946 | Soil | VAKRIMEMAQRGAQDREALVADALRFVTTNYEESSKLTN |
| Ga0310910_105190872 | 3300031946 | Soil | VVAKRIIEMAQRGVEDRQALVTDALRFIAANYEQPTKFGK |
| Ga0306926_101143381 | 3300031954 | Soil | VVAKRIMEMAQRGVQDREALVADALRFVTTNYEESSKLTN |
| Ga0306922_108225722 | 3300032001 | Soil | MREAVAKRIMEMAQRGVQDRDALVADALRFVTANYEEPSKLTS |
| Ga0306924_110624851 | 3300032076 | Soil | RPAYSRVMREVVAKRIMELAQRGEQDRETLVVDALLFVVANYEDPALR |
| Ga0311301_1002616314 | 3300032160 | Peatlands Soil | MREVVAKRIMEMAQRGVQDREALVADALRFITANYEQPSKLAK |
| Ga0310914_104170601 | 3300033289 | Soil | KRIMEMAQRGVQDREALVADALRFVTTNYEESSKLTN |
| Ga0310914_110201372 | 3300033289 | Soil | KRIMEMAQRGVQDRGALVADALHFVAANYEEPSKLTN |
| ⦗Top⦘ |