


| Basic Information | |
|---|---|
| Family ID | F090660 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MATLATATEKKAQMNADEKPERKPQRGRVDDKFKIFCGT |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.74 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.185 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.519 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.074 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF08544 | GHMP_kinases_C | 86.11 |
| PF00781 | DAGK_cat | 0.93 |
| PF01557 | FAA_hydrolase | 0.93 |
| PF05875 | Ceramidase | 0.93 |
| PF13419 | HAD_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01DCDZC | Not Available | 541 | Open in IMG/M |
| 3300000567|JGI12270J11330_10151157 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300001661|JGI12053J15887_10312765 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300001915|JGI24741J21665_1042887 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005184|Ga0066671_10419708 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005332|Ga0066388_103145196 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300005434|Ga0070709_10537735 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005439|Ga0070711_100380974 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300005459|Ga0068867_100291599 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005529|Ga0070741_11089995 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005538|Ga0070731_10418117 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005541|Ga0070733_10861393 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005542|Ga0070732_10301698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 962 | Open in IMG/M |
| 3300005553|Ga0066695_10724298 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005554|Ga0066661_10329439 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005566|Ga0066693_10423873 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005615|Ga0070702_101790916 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005718|Ga0068866_10961301 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005842|Ga0068858_101651785 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005895|Ga0075277_1031695 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300006028|Ga0070717_10265093 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300006102|Ga0075015_100513655 | Not Available | 691 | Open in IMG/M |
| 3300006176|Ga0070765_100344782 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300006354|Ga0075021_10084529 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300006354|Ga0075021_10995719 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300007258|Ga0099793_10291369 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300009092|Ga0105250_10097674 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300009162|Ga0075423_12194664 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010043|Ga0126380_10352782 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300010043|Ga0126380_10802094 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300010048|Ga0126373_10125738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2405 | Open in IMG/M |
| 3300010358|Ga0126370_10826102 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300010359|Ga0126376_12166158 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010360|Ga0126372_10449131 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300010361|Ga0126378_11020296 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300010361|Ga0126378_11322081 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010373|Ga0134128_12392251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300010373|Ga0134128_12521894 | Not Available | 567 | Open in IMG/M |
| 3300010376|Ga0126381_104103429 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010401|Ga0134121_11921448 | Not Available | 622 | Open in IMG/M |
| 3300011060|Ga0138583_1056064 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300011089|Ga0138573_1085327 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300011090|Ga0138579_1225587 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300011120|Ga0150983_13915336 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300011120|Ga0150983_16087493 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300011271|Ga0137393_11475949 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012350|Ga0137372_10770582 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012357|Ga0137384_10307429 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300012487|Ga0157321_1031903 | Not Available | 542 | Open in IMG/M |
| 3300012923|Ga0137359_10343421 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300012924|Ga0137413_11170583 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012925|Ga0137419_10555365 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300012957|Ga0164303_10685126 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012958|Ga0164299_10455885 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300012960|Ga0164301_10101852 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300012975|Ga0134110_10582594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300013105|Ga0157369_11202058 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300015358|Ga0134089_10185070 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300015359|Ga0134085_10465889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017993|Ga0187823_10044718 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300018433|Ga0066667_11020690 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300019275|Ga0187798_1505002 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300019879|Ga0193723_1052137 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300020582|Ga0210395_11384441 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300021088|Ga0210404_10282601 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300021151|Ga0179584_1160144 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300021445|Ga0182009_10216394 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021478|Ga0210402_10420815 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300021559|Ga0210409_10562222 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300021861|Ga0213853_10619289 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300022525|Ga0242656_1085949 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300022533|Ga0242662_10043515 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300022557|Ga0212123_10028190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5896 | Open in IMG/M |
| 3300022720|Ga0242672_1037511 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300025711|Ga0207696_1110511 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300025898|Ga0207692_10725273 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300025906|Ga0207699_10032217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2952 | Open in IMG/M |
| 3300025906|Ga0207699_10935742 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300025907|Ga0207645_10001345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 20168 | Open in IMG/M |
| 3300025913|Ga0207695_10255145 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300025914|Ga0207671_10956134 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025916|Ga0207663_10085301 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300025928|Ga0207700_10074593 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300025944|Ga0207661_11678634 | Not Available | 580 | Open in IMG/M |
| 3300025981|Ga0207640_10149940 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300025987|Ga0208906_1026724 | Not Available | 511 | Open in IMG/M |
| 3300026142|Ga0207698_11249403 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300026296|Ga0209235_1283113 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300026315|Ga0209686_1021666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2547 | Open in IMG/M |
| 3300026523|Ga0209808_1120873 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300027371|Ga0209418_1034668 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027867|Ga0209167_10521377 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300029984|Ga0311332_10086181 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300030545|Ga0210271_10119973 | Not Available | 664 | Open in IMG/M |
| 3300030990|Ga0308178_1063063 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031057|Ga0170834_105933069 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1111266 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031446|Ga0170820_16343852 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031474|Ga0170818_115405922 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300031681|Ga0318572_10197117 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300031708|Ga0310686_104799280 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031754|Ga0307475_10213862 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300031770|Ga0318521_10018731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3184 | Open in IMG/M |
| 3300031820|Ga0307473_10729098 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031938|Ga0308175_100287711 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300032042|Ga0318545_10276606 | Not Available | 603 | Open in IMG/M |
| 3300032119|Ga0316051_1029803 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032180|Ga0307471_102732706 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.85% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025987 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_08452980 | 2170459024 | Grass Soil | MATLGTPAEKKGQQVPEEKGERKPRPRVDDKFKIFSGTAN |
| JGI12270J11330_101511571 | 3300000567 | Peatlands Soil | MATLATATEKKAQMSADEKPERKPQRSRADDKFKIFCGTAN |
| JGI12053J15887_103127653 | 3300001661 | Forest Soil | MATLATVTEKKPQVGADEKTERKPQRGRVDDKFKI |
| JGI24741J21665_10428871 | 3300001915 | Corn Rhizosphere | MSTVATATDKKAHMGTDEKPERKLQRARVDDKFKI |
| Ga0066671_104197083 | 3300005184 | Soil | MAIATATEKKPLMSPDEKSERKPQRARVDDKFKIFCGTANEPLCD |
| Ga0066388_1031451961 | 3300005332 | Tropical Forest Soil | MATLVTPPEKKGQQVTEEKPERKVRPRVDEKFKIFSGTAN |
| Ga0070709_105377351 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATATEKKAQMSADEKPERKPQRGRVDDRFKIFCGTA |
| Ga0070711_1003809741 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVATASEKSQMTTDDKPERKPQRARVDDKFKIFCGTAN |
| Ga0068867_1002915993 | 3300005459 | Miscanthus Rhizosphere | MATLATATEKKPHMGSDEKTERKPLRSRVDDRFKIFCGTANPALCDD |
| Ga0070741_110899951 | 3300005529 | Surface Soil | MATLATATEKKATMSPDEKPERKPQRARVDDKFKIFCG |
| Ga0070731_104181173 | 3300005538 | Surface Soil | MATLATATEKKIGAEDKRERKPQRARVDDKFKIFCGTANQP |
| Ga0070733_108613933 | 3300005541 | Surface Soil | MATLATATEKKPMGPEEKTERKPQRARVDEKFKIFCGTANVP |
| Ga0070732_103016983 | 3300005542 | Surface Soil | MATLVTPTEKKVPAAPEEKGDRRGRSRVDEKFKIFSGTANEP |
| Ga0066695_107242981 | 3300005553 | Soil | MATFATATDKKAHMSADDKSERKPHRARVDDKFKIFC |
| Ga0066661_103294393 | 3300005554 | Soil | MATLATATEKKTIGMSADEKHERKPHRVRVDDKFKIFCGTANQP |
| Ga0066693_104238733 | 3300005566 | Soil | MATLATATEKKAHMGVDEKSERKPQRARVDDKFKI |
| Ga0070702_1017909163 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATTTEKKTHVNADEKPERKPQRPRVDDRFKIFCGTAN |
| Ga0068866_109613011 | 3300005718 | Miscanthus Rhizosphere | MATLATATEKKPHLGSDEKTERKPFRSRVDDRFKIFC |
| Ga0068858_1016517851 | 3300005842 | Switchgrass Rhizosphere | MATLATATEKKAQMNADEKAERKPQRGRVDDKFKIFCGTA |
| Ga0075277_10316951 | 3300005895 | Rice Paddy Soil | MATLATATEKKPQMSADEKPERKPVRARVDDKFKIF |
| Ga0070717_102650931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MATITVTAEKKMTPDEKPAHKPHRARVDDKFKIFCG |
| Ga0075015_1005136551 | 3300006102 | Watersheds | MATLATPAEKKGQQVPEEKSERKPRPRVDDKFKIFCGTA |
| Ga0070765_1003447823 | 3300006176 | Soil | MATLATATEKKPHTGAEEKSERKPQRGRVDDKFKIFS |
| Ga0075021_100845294 | 3300006354 | Watersheds | MATLATQTEKKAPMNPDEKPERRPQRARVDDKFKIFCGTANEAL |
| Ga0075021_109957191 | 3300006354 | Watersheds | MATLVTATEKKAQMSTDEKPERKPQRVRVDDKLKIFCGTA |
| Ga0099793_102913693 | 3300007258 | Vadose Zone Soil | MATLATATEKKAHLGVDEKSERKPQRARVDDKLKIFCGTAN |
| Ga0105250_100976743 | 3300009092 | Switchgrass Rhizosphere | MSTVATATDKKAHMGTDEKPERKLQRARVDDKFKIFC |
| Ga0075423_121946643 | 3300009162 | Populus Rhizosphere | MATLATATEKKAQMNADEKAERKPQRGRVDDKFKIFCG |
| Ga0126380_103527821 | 3300010043 | Tropical Forest Soil | MATLATPAEKKGQQVPEEKSERKPRPRVDEKFKIF |
| Ga0126380_108020941 | 3300010043 | Tropical Forest Soil | MATTIATAEKKMTPEEKPAHKPHRARVDDKFKIFCGTANPDL |
| Ga0126373_101257381 | 3300010048 | Tropical Forest Soil | MPSFAATAEKKMSADEKHERKPQRARVDDKFKIFCGT |
| Ga0126370_108261023 | 3300010358 | Tropical Forest Soil | MSTLAATAEKKMSADEKHERKPQRARVDDKFKIFCGTANQP |
| Ga0126376_121661583 | 3300010359 | Tropical Forest Soil | MSTVATATEKKPHMSADEKTERKPQRARVDDKFKIFCGT |
| Ga0126372_104491311 | 3300010360 | Tropical Forest Soil | MATLVTPPEKKGQQVTEEKPERKVRPRVDEKFKIFSGT |
| Ga0126378_110202963 | 3300010361 | Tropical Forest Soil | MATLAATAEKKMSADEKHERKPQRARVDDKFKIFCG |
| Ga0126378_113220813 | 3300010361 | Tropical Forest Soil | MATLATTAEKKGRLGAEEKPERKPQRARVDDKFKIFCGTA |
| Ga0134128_123922511 | 3300010373 | Terrestrial Soil | MATLATATEKKAHMSADEKSERKPQRARIDDKFKIF |
| Ga0134128_125218943 | 3300010373 | Terrestrial Soil | MATLATAAEKKMIPDEKHDRKPQRARVDDKFKIFCGTANTPLAD |
| Ga0126381_1041034291 | 3300010376 | Tropical Forest Soil | MATLATTAEKKGRLGAEEKPERKPQRARVDDKFKIFCGTANE |
| Ga0134121_119214481 | 3300010401 | Terrestrial Soil | MSTVATATDKKAHMGTDEKTERKLQRARVDDKFKI |
| Ga0138583_10560641 | 3300011060 | Peatlands Soil | MATLATATEKKPQMGAEEKSERKPQRGRVDDKFKIFS |
| Ga0138573_10853271 | 3300011089 | Peatlands Soil | MATLATVTEKKAQMATEEKSERKPQRSRADDKFKIFSV |
| Ga0138579_12255871 | 3300011090 | Peatlands Soil | MATLATATEKKAHMSAEEKPERKPQRSRVDDKFKIFCGTANE |
| Ga0150983_139153361 | 3300011120 | Forest Soil | MATLATATEKKVQVSAEEKPERKPVRSRADDKFKIFSGTANE |
| Ga0150983_160874933 | 3300011120 | Forest Soil | MATLATATEKKMSADEKPERKPHRARVDEKFKIFCGTANQPLAE |
| Ga0137393_114759493 | 3300011271 | Vadose Zone Soil | MATLVTATEKKVQAGVDEKPERKPQRARVDDKFKIFCGTANESLAD |
| Ga0137372_107705823 | 3300012350 | Vadose Zone Soil | MATLATATEKKPGMSPEEKHERKPHRARVDDKFKIFCGTANQP |
| Ga0137384_103074293 | 3300012357 | Vadose Zone Soil | MATLATATEKKITGMSADEKHERKPHRVRVDDKFKIFCGTANQ |
| Ga0157321_10319031 | 3300012487 | Arabidopsis Rhizosphere | MSTVATATDKKAHMGTDEKPERKLQRARVDDKFKIFCGTANEALA |
| Ga0137359_103434211 | 3300012923 | Vadose Zone Soil | MATLATAAEKKMSSEEKHERKPHRARVDDKFKIFCG |
| Ga0137413_111705831 | 3300012924 | Vadose Zone Soil | MATLATTTEKKTHVNADEKPERKPQRPRVDDKFKIFCGT |
| Ga0137419_105553651 | 3300012925 | Vadose Zone Soil | MATLATATEKKAQMSADEKPERRPQRGRVDDRFKI |
| Ga0164303_106851261 | 3300012957 | Soil | MATITATAEKKMTPEEKPAHKPHRARVDDKFKIFCGTAN |
| Ga0164299_104558853 | 3300012958 | Soil | MATLATATEKKMSATPEEKHERKPHRARIDDKFKIFSGT |
| Ga0164301_101018521 | 3300012960 | Soil | MATFVFTTATTTEKKVQQPDSKPERKPQRAKADDKFKIFS |
| Ga0134110_105825943 | 3300012975 | Grasslands Soil | MATLVTATEKKVQAGVDDKPERKPQRARVDDKFKIFCGTANEALA |
| Ga0157369_112020581 | 3300013105 | Corn Rhizosphere | MATLATATEKKAQMNADEKAERKPQRGRVDDKFKIF |
| Ga0134089_101850701 | 3300015358 | Grasslands Soil | MATLVTATEKKVQAGVDEKPERKPQRARVDDKFKIFCGTA |
| Ga0134085_104658893 | 3300015359 | Grasslands Soil | MATLATATEKKITGMSADEKHERKPHRVRVDDKFKIFCGTANQPL |
| Ga0187823_100447183 | 3300017993 | Freshwater Sediment | MATLVTPAEKKGQQVPEEKSERKVRPRVDEKFKIFSGTAN |
| Ga0066667_110206903 | 3300018433 | Grasslands Soil | MATLATATEKKAHMSADEKPERKPHRGRVDDKFKIFCGTAN |
| Ga0187798_15050021 | 3300019275 | Peatland | MATLATATEKKSQMSPEEKPERKPARLRVDDKFKIFSGT |
| Ga0193723_10521371 | 3300019879 | Soil | MATLATATEKKAHMGVDEKSERKPQRARVDDKFKIFCG |
| Ga0210395_113844411 | 3300020582 | Soil | MATVATVTKAQVGTEEKSERKPQRGRADDKFKIFS |
| Ga0210404_102826013 | 3300021088 | Soil | MATLATPAEKKGQQVPEEKGERSKPRPRVDDKFKIFCGTANEALADEVC |
| Ga0179584_11601443 | 3300021151 | Vadose Zone Soil | MATLATATEKKAQMSADEKPERKPQRGRVDDRFKIFCGTANEPLCD |
| Ga0182009_102163941 | 3300021445 | Soil | MAIATATEKKPLMSPDEKSERKPQRARVDDKFKIF |
| Ga0210402_104208153 | 3300021478 | Soil | MATLATPAEKKGQQVPEDKSERKPQRPRVDDKFKIFCGTAN |
| Ga0210409_105622223 | 3300021559 | Soil | MATLATPAEKKGQQVPEEKGERKPRPRVDEKFKIFCGTAN |
| Ga0213853_106192891 | 3300021861 | Watersheds | MATLATATEKKSQPVSDERPERKPQRTRVDDKFKIFCGTA |
| Ga0242656_10859493 | 3300022525 | Soil | MATLATVTEKKAQVGAEEKPERKPQRSRADDKFKIFSGTANEA |
| Ga0242662_100435153 | 3300022533 | Soil | MATLATPAEKKGQQVPEEKSERNRPARPRVDEKFKIF |
| Ga0212123_100281901 | 3300022557 | Iron-Sulfur Acid Spring | MATLATATEKKMSADEKHERKPHRARVDEKFKIFC |
| Ga0242672_10375111 | 3300022720 | Soil | MATLATPAEKKGQQVPEDRAERKPRPRVDEKFKIFCGTANEALTD |
| Ga0207696_11105113 | 3300025711 | Switchgrass Rhizosphere | MSTVATATDKKAHMGTDEKPERKLQRARVDDKFKIFCGTAN |
| Ga0207692_107252733 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATATEKKAHMSADEKAERKPQRTRVDDKFKIFCGT |
| Ga0207699_100322175 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATPAEKKGQQVPEEKSERNRPARPRVDEKFKIFSGTAN |
| Ga0207699_109357423 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATATEKKAQMNADEKPERKPQRGRVDDKFKIFCG |
| Ga0207645_1000134523 | 3300025907 | Miscanthus Rhizosphere | MSTVATATDKKAHMGTDEKPERKLQRARVDDKFKIFCG |
| Ga0207695_102551453 | 3300025913 | Corn Rhizosphere | MATLATATEKKMSPDEKHDRKPHRARVDDKFKIFC |
| Ga0207671_109561343 | 3300025914 | Corn Rhizosphere | MATLATATEKKAQMNADEKAERKPQRGRVDDKFKIFC |
| Ga0207663_100853014 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATPAEKKGQQVPEEKSERNRPARPRVDEKFKIFSGTANE |
| Ga0207700_100745935 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLATAAEKKMSADEKHDRKPQRVRVDDKFKIFCG |
| Ga0207661_116786341 | 3300025944 | Corn Rhizosphere | MATLATAAEKKMSADEKHDRKPQRVRVDDKFKIFCGMANMP |
| Ga0207640_101499404 | 3300025981 | Corn Rhizosphere | MATLATAAEKKMNADEKHDRKPQRVRVDDKFKIFCGTANM |
| Ga0208906_10267243 | 3300025987 | Rice Paddy Soil | MATVAPAAEGKMQQSEPKVDRRPQRARVDEKFKIFCGTANPQLAE |
| Ga0207698_112494033 | 3300026142 | Corn Rhizosphere | MAIATATEKKPLMSPDEKSERKPQRARVDDKFKIFCGTA |
| Ga0209235_12831133 | 3300026296 | Grasslands Soil | MATLVTATEKKVQAGVDEKPERKPQRARVDDKFKIFCGTAN |
| Ga0209686_10216661 | 3300026315 | Soil | MATLATTADKKAPVSPEEKPERKPQRSRVDDKFKIFCGT |
| Ga0209808_11208733 | 3300026523 | Soil | MATLATATDKKMSPDEKHERKPHRARVDEKFKIFCGTAN |
| Ga0209418_10346681 | 3300027371 | Forest Soil | MATLATPAEKKGQQVPEEKSERKPVRARVDDKFKIFCGTANEP |
| Ga0209167_105213773 | 3300027867 | Surface Soil | MATLATVTEKKAQVGADEKSERKPQRGRVDDKFKIFSG |
| Ga0311332_100861811 | 3300029984 | Fen | MATLATATEKKAQMTPDEKPERKVQRGRVDDKFKIFCGTANEPLC |
| Ga0210271_101199731 | 3300030545 | Soil | MATLATATEKAADKKAPAGPDDKPERKPQRARVDDKFKIFC |
| Ga0308178_10630631 | 3300030990 | Soil | MATLATATEKKPHMSSDEKAERKPQRSRVDDRFKIF |
| Ga0170834_1059330691 | 3300031057 | Forest Soil | MATLATATEKKVAISPDEKTERKPQRGRVDDKFKIFCGTANE |
| (restricted) Ga0255312_11112661 | 3300031248 | Sandy Soil | MATLATATEKKAQMNADEKPERKPQRGRVDDKFKIFCGT |
| Ga0170820_163438523 | 3300031446 | Forest Soil | MATLVTTTEKKTGVSAEEKHERKPHRGRVDDKLKKKE |
| Ga0170818_1154059223 | 3300031474 | Forest Soil | MATLATATEKKMIPDDKHERKPHRARVDDKFKVFCGTANQPLAD |
| Ga0318572_101971173 | 3300031681 | Soil | MATLATPAEKKGQQVPEEKSERKARPRVDEKFKIFSGT |
| Ga0310686_1047992803 | 3300031708 | Soil | MATLATATDKKALMGAEEKPERKPQRGRVDDKFKIFSGT |
| Ga0307475_102138621 | 3300031754 | Hardwood Forest Soil | MATLATPAEKKGQQVPEEKSERKARPRVDDKFKIFCGTAN |
| Ga0318521_100187316 | 3300031770 | Soil | MATLATPAEKKGQQVPEEKSERKARPRVDEKFKIFSGTANEALA |
| Ga0307473_107290981 | 3300031820 | Hardwood Forest Soil | MATLATATEKKAHMSADEKPERKPHRGRVDDKFKIFCGTA |
| Ga0308175_1002877111 | 3300031938 | Soil | MATLATAVEKKMSPDEKHAKPQRSRVDDKFKIFCGTA |
| Ga0318545_102766063 | 3300032042 | Soil | MATLATPAEKKGQQVPEEKSERKARPRVDEKFKILSGTANEALADEV |
| Ga0316051_10298031 | 3300032119 | Soil | MATLATVTEKKAQTVADDKSERKPQRSRADDKFKIF |
| Ga0307471_1027327061 | 3300032180 | Hardwood Forest Soil | MATLATATDKKAQMSPDEKPERKPQRGRVDDRFKIFCG |
| ⦗Top⦘ |