


| Basic Information | |
|---|---|
| Family ID | F090646 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MANREQRSNREKKKPKSDKKAAPVPAVKPPAYVEPQLIRKPHKGKDWV |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.44 % |
| % of genes near scaffold ends (potentially truncated) | 16.67 % |
| % of genes from short scaffolds (< 2000 bps) | 69.44 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.889 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (9.259 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.519 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.519 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.26% β-sheet: 0.00% Coil/Unstructured: 94.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00326 | Peptidase_S9 | 8.33 |
| PF05257 | CHAP | 7.41 |
| PF07311 | Dodecin | 7.41 |
| PF08241 | Methyltransf_11 | 3.70 |
| PF00578 | AhpC-TSA | 2.78 |
| PF02897 | Peptidase_S9_N | 2.78 |
| PF01381 | HTH_3 | 1.85 |
| PF13358 | DDE_3 | 1.85 |
| PF12847 | Methyltransf_18 | 0.93 |
| PF13432 | TPR_16 | 0.93 |
| PF00583 | Acetyltransf_1 | 0.93 |
| PF12695 | Abhydrolase_5 | 0.93 |
| PF00903 | Glyoxalase | 0.93 |
| PF01522 | Polysacc_deac_1 | 0.93 |
| PF03695 | UPF0149 | 0.93 |
| PF00479 | G6PD_N | 0.93 |
| PF00144 | Beta-lactamase | 0.93 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.93 |
| PF07719 | TPR_2 | 0.93 |
| PF02785 | Biotin_carb_C | 0.93 |
| PF13649 | Methyltransf_25 | 0.93 |
| PF01839 | FG-GAP | 0.93 |
| PF12850 | Metallophos_2 | 0.93 |
| PF12697 | Abhydrolase_6 | 0.93 |
| PF09285 | Elong-fact-P_C | 0.93 |
| PF12441 | CopG_antitoxin | 0.93 |
| PF07885 | Ion_trans_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 7.41 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 2.78 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 2.78 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
| COG3079 | Uncharacterized conserved protein YgfB, UPF0149 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.89 % |
| Unclassified | root | N/A | 36.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000553|TBL_comb47_HYPODRAFT_10027361 | Not Available | 4190 | Open in IMG/M |
| 3300001409|JGI20185J14861_1000915 | All Organisms → cellular organisms → Bacteria | 3942 | Open in IMG/M |
| 3300004092|Ga0062389_101778505 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300004114|Ga0062593_101760811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300004156|Ga0062589_102742045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300004479|Ga0062595_100559938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300005238|Ga0073692_1022560 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005335|Ga0070666_10023781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3989 | Open in IMG/M |
| 3300005434|Ga0070709_10376431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300005434|Ga0070709_10402994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300005468|Ga0070707_101343719 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005533|Ga0070734_10120042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 1536 | Open in IMG/M |
| 3300005534|Ga0070735_10173583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300005538|Ga0070731_11177189 | Not Available | 506 | Open in IMG/M |
| 3300005538|Ga0070731_11183159 | Not Available | 505 | Open in IMG/M |
| 3300005539|Ga0068853_101073556 | Not Available | 776 | Open in IMG/M |
| 3300005542|Ga0070732_10149867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1388 | Open in IMG/M |
| 3300005545|Ga0070695_101623970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
| 3300005547|Ga0070693_101015512 | Not Available | 628 | Open in IMG/M |
| 3300005764|Ga0066903_105236043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300005764|Ga0066903_107835791 | Not Available | 549 | Open in IMG/M |
| 3300006176|Ga0070765_100956906 | Not Available | 809 | Open in IMG/M |
| 3300006237|Ga0097621_100641308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300006237|Ga0097621_100990253 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006354|Ga0075021_10340400 | Not Available | 934 | Open in IMG/M |
| 3300006358|Ga0068871_100650823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
| 3300006638|Ga0075522_10218326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300006755|Ga0079222_10006573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3952 | Open in IMG/M |
| 3300006755|Ga0079222_10664322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 814 | Open in IMG/M |
| 3300009175|Ga0073936_10119528 | Not Available | 2078 | Open in IMG/M |
| 3300009649|Ga0105855_1238968 | Not Available | 558 | Open in IMG/M |
| 3300009650|Ga0105857_1211715 | Not Available | 566 | Open in IMG/M |
| 3300009660|Ga0105854_1089066 | Not Available | 957 | Open in IMG/M |
| 3300009660|Ga0105854_1276459 | Not Available | 580 | Open in IMG/M |
| 3300009684|Ga0114958_10250489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 875 | Open in IMG/M |
| 3300010373|Ga0134128_12591071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300010375|Ga0105239_12692386 | Not Available | 580 | Open in IMG/M |
| 3300010396|Ga0134126_10060501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4723 | Open in IMG/M |
| 3300010396|Ga0134126_11408062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300010397|Ga0134124_12118958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300012929|Ga0137404_10290322 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300013297|Ga0157378_10090019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2788 | Open in IMG/M |
| 3300014121|Ga0181457_10326 | Not Available | 5394 | Open in IMG/M |
| 3300014167|Ga0181528_10688198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300014205|Ga0172380_10679964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300014489|Ga0182018_10519899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300014495|Ga0182015_10311113 | Not Available | 1029 | Open in IMG/M |
| 3300014499|Ga0182012_10975712 | Not Available | 533 | Open in IMG/M |
| 3300014501|Ga0182024_10252927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2361 | Open in IMG/M |
| 3300014655|Ga0181516_10437357 | Not Available | 669 | Open in IMG/M |
| 3300014838|Ga0182030_11432428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300015197|Ga0167638_1005483 | Not Available | 2957 | Open in IMG/M |
| 3300017927|Ga0187824_10014127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2317 | Open in IMG/M |
| 3300017927|Ga0187824_10054568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300017936|Ga0187821_10480630 | Not Available | 518 | Open in IMG/M |
| 3300017948|Ga0187847_10098001 | Not Available | 1619 | Open in IMG/M |
| 3300017959|Ga0187779_10013660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4642 | Open in IMG/M |
| 3300021180|Ga0210396_10092245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2744 | Open in IMG/M |
| 3300021403|Ga0210397_10022122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3918 | Open in IMG/M |
| 3300021478|Ga0210402_10835590 | Not Available | 847 | Open in IMG/M |
| 3300021519|Ga0194048_10037240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2014 | Open in IMG/M |
| 3300021560|Ga0126371_10523960 | Not Available | 1334 | Open in IMG/M |
| 3300022555|Ga0212088_10062215 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300025494|Ga0207928_1045481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300025898|Ga0207692_10436171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 822 | Open in IMG/M |
| 3300025903|Ga0207680_10016704 | All Organisms → cellular organisms → Bacteria | 3859 | Open in IMG/M |
| 3300025906|Ga0207699_10089864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1926 | Open in IMG/M |
| 3300025906|Ga0207699_10329065 | Not Available | 1074 | Open in IMG/M |
| 3300025910|Ga0207684_10387657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300025911|Ga0207654_10428541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300026035|Ga0207703_10005844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9853 | Open in IMG/M |
| 3300027119|Ga0209522_1033781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 628 | Open in IMG/M |
| 3300027559|Ga0209222_1002971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3842 | Open in IMG/M |
| 3300027712|Ga0209499_1173091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300027826|Ga0209060_10032934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2591 | Open in IMG/M |
| 3300027842|Ga0209580_10429470 | Not Available | 659 | Open in IMG/M |
| 3300027986|Ga0209168_10165264 | Not Available | 1118 | Open in IMG/M |
| 3300028556|Ga0265337_1120622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300028785|Ga0302201_10096030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1345 | Open in IMG/M |
| 3300028788|Ga0302189_10075986 | Not Available | 1578 | Open in IMG/M |
| 3300028800|Ga0265338_10910800 | Not Available | 598 | Open in IMG/M |
| 3300029951|Ga0311371_10908632 | Not Available | 1063 | Open in IMG/M |
| 3300030020|Ga0311344_10660234 | Not Available | 882 | Open in IMG/M |
| 3300030503|Ga0311370_10996543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300030617|Ga0311356_11224980 | Not Available | 690 | Open in IMG/M |
| 3300031236|Ga0302324_102731492 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031240|Ga0265320_10000685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 25817 | Open in IMG/M |
| 3300031240|Ga0265320_10481868 | Not Available | 548 | Open in IMG/M |
| 3300031247|Ga0265340_10013766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4242 | Open in IMG/M |
| 3300031249|Ga0265339_10086795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1645 | Open in IMG/M |
| 3300031708|Ga0310686_104496644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300031711|Ga0265314_10093243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
| 3300031711|Ga0265314_10718084 | Not Available | 504 | Open in IMG/M |
| 3300031716|Ga0310813_10015969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5004 | Open in IMG/M |
| 3300031716|Ga0310813_10208784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1605 | Open in IMG/M |
| 3300031716|Ga0310813_10301201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1352 | Open in IMG/M |
| 3300031720|Ga0307469_10691105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 924 | Open in IMG/M |
| 3300031740|Ga0307468_102348055 | Not Available | 519 | Open in IMG/M |
| 3300031759|Ga0316219_1000493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 53750 | Open in IMG/M |
| 3300032828|Ga0335080_10136467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2719 | Open in IMG/M |
| 3300032829|Ga0335070_10099567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3045 | Open in IMG/M |
| 3300033412|Ga0310810_10194241 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300033475|Ga0310811_10019129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9014 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.63% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 3.70% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.85% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.93% |
| Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001409 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005238 | Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014121 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In4 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02548110 | 2199352024 | Soil | KKKPKADKKXXXXXXKPPAYIEPQLVRKPHKGKDWT |
| TBL_comb47_HYPODRAFT_100273613 | 3300000553 | Freshwater | MANREQKNSREKKKPKADKKAAPAAAKPAFAEPALIRKPHKGKDWS* |
| JGI20185J14861_10009151 | 3300001409 | Arctic Peat Soil | EQKSNREKKKPKSDKKGAPVTTKAPAYVEPQLVRKPHKGKDWT* |
| Ga0062389_1017785052 | 3300004092 | Bog Forest Soil | MANREQRGNKEKKKPKADQKAAVSTAKQPAYVEPQLVRKPHKGKPDWS* |
| Ga0062593_1017608112 | 3300004114 | Soil | MANREQRSNREKKKPKAEKKGVQGKSATPAYVEPALVRKPHKGKGEG* |
| Ga0062589_1027420451 | 3300004156 | Soil | MANREQRSNREKKKPKSDKKAAPVPAVKPPAYVEPQLIRKPHKGKDWV* |
| Ga0062595_1005599382 | 3300004479 | Soil | MANREQRSNREKKKPKSDKKAAPVPGVKPPAYVEPQLIRKPHKGKDWV* |
| Ga0073692_10225602 | 3300005238 | Soil | MANREQRGNKEKKKPKADKKAAPVTVKQPGYVEPQLIRKPHKGKEWT* |
| Ga0070666_100237814 | 3300005335 | Switchgrass Rhizosphere | MANREQRSSKEKKKPKADKKAAQGSATPGFKTPAYVEPQLIRKPHKGKDWT* |
| Ga0070691_110871351 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RSNREKKKPKSDKKAQPPKPATPAYVEPVLVRKPHKGKGEA* |
| Ga0070709_103764312 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MANREQRSNREKKKPKSDKKAAPIPAVKPPAYVEPQLIRKPHKGKDWV* |
| Ga0070709_104029941 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MANREQRGNKEKKKPKADKKIAPITTKPPAYIEPQLVRKPHKGKDWT* |
| Ga0070707_1013437192 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MANREQRSNREKKKPKADKKAASPIPAVKTPAYVEPQLVRKPHKGKDWV* |
| Ga0070734_101200424 | 3300005533 | Surface Soil | MANREQRGNKEKKKPKADKKSAPAPVKAPAYVEPQLVRKPHKGKDWT* |
| Ga0070735_101735832 | 3300005534 | Surface Soil | MANREQRGNKEKKKPKADKKIAPIAAKPPAYIEPQLVRKPHKGKQEF* |
| Ga0070731_111771892 | 3300005538 | Surface Soil | MANREQRGNKEKKKPKADKKIAPVTAKPPAYIEPQLVRKPHKGKDWT* |
| Ga0070731_111831592 | 3300005538 | Surface Soil | PMANREQRSSKEKKKPKADKKAAAGSAAPSFKTPAYVEPQLIRKPHKGKDWT* |
| Ga0068853_1010735562 | 3300005539 | Corn Rhizosphere | NREQRSNREKKKPKSDKKAVPMPVKTPAYVEPQLVRKPHKGKDWT* |
| Ga0070732_101498672 | 3300005542 | Surface Soil | MANREQRGNKEKKKPKADKKIAPITAKPPAYIEPQLVRKPHKGKQEF* |
| Ga0070695_1016239701 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | REKKKPKSDKKAAPVPAVKPPAYVEPQLIRKPHKGKDWV* |
| Ga0070693_1010155121 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MANREQRSNREKKKPKSDKKAVPMPVKTPAYVEPQLVRKPHKGKDWT* |
| Ga0066903_1052360431 | 3300005764 | Tropical Forest Soil | MANREQRSNKEKKKPKADKKAPPVTTVKQPAYVEPQLIRKPHKGKDW |
| Ga0066903_1078357912 | 3300005764 | Tropical Forest Soil | MANREQRSNREKKKPKADKKAVPVTTTVKQPGYVEPQLIRKPHKGKDWA* |
| Ga0070765_1009569063 | 3300006176 | Soil | MANREQKSNREKKKPKADKKAAPVTAQARPAFQEPALIRKPHKGKDWT* |
| Ga0097621_1006413081 | 3300006237 | Miscanthus Rhizosphere | MANREQKNNREKKKPKADKKAAPVIAKPAFAEPALVRKPHKGKDWS* |
| Ga0097621_1009902532 | 3300006237 | Miscanthus Rhizosphere | MRYSESISRRAVMANREQRSNREKKKPKSDKKAAPIPAAKTPAYVEPQLIRKPHKGKDWV |
| Ga0075021_103404001 | 3300006354 | Watersheds | MANREQKNNREKKKPKADKKAGSAPSSGKPVFAEPALIRKPHKGKS* |
| Ga0068871_1006508232 | 3300006358 | Miscanthus Rhizosphere | MANREQRGNKEKKKPKADKKAAPVSAKPAFAEPALIRKPHKGKA* |
| Ga0075522_102183262 | 3300006638 | Arctic Peat Soil | MANREQRGNKEKKKPKSDKKGAPVTTSVKAPAYVEPQLVRKPHKGKDWT* |
| Ga0079222_100065734 | 3300006755 | Agricultural Soil | MANREQRSNREKKKPKSDKKAAPIPAVKPPAYVEPQLIRKPHKSKDWV* |
| Ga0079222_106643222 | 3300006755 | Agricultural Soil | MANREQRSNREKKKPKADKKAAPPIPAVKPPAYVEPQLIRKPHKGKDWV* |
| Ga0073936_101195283 | 3300009175 | Freshwater Lake Hypolimnion | MANREQKNSREKKKPKADKKAAPVAAKPAFAEPALIRKPHKGKDWS* |
| Ga0105855_12389681 | 3300009649 | Permafrost Soil | MANREQRSNKEKKKPKSDKRGAPAPVKAPAYVEPQLVR |
| Ga0105857_12117152 | 3300009650 | Permafrost Soil | MANREPRSNKEKKKPKSDKKGAPAPVKAPAYVEPQLVRKPHKGKDWT* |
| Ga0105854_10890661 | 3300009660 | Permafrost Soil | MANREQKSSREKKKPKADKKAAPVAAGKPAFAEPALIRKPHKGKDWS* |
| Ga0105854_12764591 | 3300009660 | Permafrost Soil | MANREQRSNKEKKKPKSDKRGAPAPVKAPAYVEPQLVRKPHKGKDWT* |
| Ga0114958_102504892 | 3300009684 | Freshwater Lake | MANREQKNSREKKKPKADKKAAPVSAKPGFAEPALIRKPHKGKDWS* |
| Ga0134125_116923181 | 3300010371 | Terrestrial Soil | KKKPKADKKAAQATATFKTPAYVEPQLIRKPHKGKDWT* |
| Ga0134128_125910711 | 3300010373 | Terrestrial Soil | MANREQRSNREKKKPKSDKKAAPIPAAKTPAYVEPQLIRKPHKGKDWV* |
| Ga0105239_126923862 | 3300010375 | Corn Rhizosphere | MANREQRSSKEKKKPKADKKATQGSATPGFKTPAYVEPQLIRKPHKGKDWT* |
| Ga0134126_100605016 | 3300010396 | Terrestrial Soil | MANREQRGNKEKKKPKADKKAAQAAPVFKPPAYVEPQLVRKPHKGKDWT* |
| Ga0134126_114080622 | 3300010396 | Terrestrial Soil | MANREQKNNREKKKPKADKKAAPVSAAPKPVFQEAALIRKPHKGKDWT* |
| Ga0134124_121189582 | 3300010397 | Terrestrial Soil | HVSRRAVMANREQRSNREKKKPKSDKKAAPIPAVKPPAYVEPQLIRKPHKGKDWV* |
| Ga0137404_102903222 | 3300012929 | Vadose Zone Soil | MANREQRGNKEKKKPKADKKSVPITSKPPAYVEPQLVRKPHKGKDWT* |
| Ga0157378_100900192 | 3300013297 | Miscanthus Rhizosphere | MANREQRSNREKKKPKSAKKAAPIPAAKTPAYVEPQLIRKPHKGKDWV* |
| Ga0181457_103262 | 3300014121 | Clean Room | MANREQRSNKEKKKPKADKKGAAPAAGGIKAPAYVEPQLIRKPHKGKDWT* |
| Ga0181528_106881982 | 3300014167 | Bog | MANREQKSNREKKKPKADKKLAPVQAKPAFPEPALVRKPHKGRDQT* |
| Ga0172380_106799642 | 3300014205 | Landfill Leachate | MANREQKNNREKKKPKADKKAAPVAAKPGFAEPALIRKPHKGKDWS* |
| Ga0182018_105198992 | 3300014489 | Palsa | MANREQKSNREKKKPKADKRAAPVVQGNKPAFQEPALIRKPHKGKDWT* |
| Ga0182015_103111133 | 3300014495 | Palsa | MANREQKSNREKKKPKADKKAAPVVQGNKPAFQEPALIRKPHKGKDWT* |
| Ga0182008_101904311 | 3300014497 | Rhizosphere | KKKPKADKKTAPITTKPPAYIEPQLVRKPHKGKDWT* |
| Ga0182012_109757121 | 3300014499 | Bog | VANREQKSNREKKKPKAGAKTPPVAAKPAFAEPALVRKPHKGKD* |
| Ga0182024_102529274 | 3300014501 | Permafrost | MANREQKNNREKKKPKADKKAAPVAAKPGFAEPALIRKPHKGKDWT* |
| Ga0181516_104373572 | 3300014655 | Bog | MANREQKSNREKKKPKADKKLAPVQAKPAFPEPALARKPHKGRDQT* |
| Ga0182030_114324282 | 3300014838 | Bog | MANREQKSSREKKKPKADKKAVPVMAKPAFAEPALIRKPHKGKDWT* |
| Ga0167638_10054831 | 3300015197 | Glacier Forefield Soil | MANREQKSNREKKKPKADKGKPNMSAPVAKAPAYVMPELVRKPHKGKQDY* |
| Ga0187824_100141272 | 3300017927 | Freshwater Sediment | MANREQRSNREKKKPKADKKGSAPMTAKAPAYVEPQLIRKPHKGKDWT |
| Ga0187824_100545682 | 3300017927 | Freshwater Sediment | MANREQRGNKEKKKPKADKKIAPITAKPPAYIEPQLVRKPHKGKDWT |
| Ga0187821_104806302 | 3300017936 | Freshwater Sediment | MANREQRGNKEKKKPKADKKIAPITTKPPAYIEPQLVRKPHKGKDWT |
| Ga0187847_100980013 | 3300017948 | Peatland | MANREQKNNREKKKPKADKKAAPVTVQAKPAFQEPALIRKPHKGKDWT |
| Ga0187779_100136605 | 3300017959 | Tropical Peatland | MANREQRSNREKKKPKADKKAAPITAKAPAYVEPQLVRKPHKGKQEY |
| Ga0210396_100922452 | 3300021180 | Soil | MANREQRGNKEKKKPKADKKTAPITAKSPAYIEPQLVRKPHKGKQEY |
| Ga0210397_100221221 | 3300021403 | Soil | MANREQRGNKEKKKPKADTKKGAAPTTIKAPAYVEP |
| Ga0210402_108355901 | 3300021478 | Soil | MANREQRGNKEKKKPKADKKGAPAPVKAPAYVEPQLVRKPHKGKDWT |
| Ga0194048_100372402 | 3300021519 | Anoxic Zone Freshwater | MANREQKNSREKKKPKADKKAAPVTAKPAFAEPALIRKPHKGKDWS |
| Ga0126371_105239603 | 3300021560 | Tropical Forest Soil | MENREQRSNREKKKPKADKKAAPMAVKAPAYVEPQLIRKPHKGKDWV |
| Ga0212088_100622153 | 3300022555 | Freshwater Lake Hypolimnion | MANREQKNSREKKKPKADKKAAPVAAKPAFAEPALIRKPHKGKDWS |
| Ga0207928_10454813 | 3300025494 | Arctic Peat Soil | NREQRGNKEKKKPKADQKAGAVSTVKQPAYVEPQLVRKPHKGKPDWS |
| Ga0207692_104361712 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGREKMGYSESVSRRAVMANREQRSNREKKKPKSDKKSAPIPGVKPPAYVEPQLIRKPHKGKDWV |
| Ga0207680_100167045 | 3300025903 | Switchgrass Rhizosphere | MANREQRSSKEKKKPKADKKAAQGSATPGFKTPAYVEPQLIRKPHKGKDWT |
| Ga0207699_100898642 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MANREQRSNREKKKPKSDKKAAPIPAVKPPAYVEPQLIRKPHKGKDWV |
| Ga0207699_103290652 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QRSNREKKKPKSDKKAAPVPAVKPPAYVEPQLIRKPHKGKDWV |
| Ga0207684_103876571 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MANREQRSNREKKKPKADKKAASPIPAVKTPAYVEPQLVRKPHKGKDWV |
| Ga0207654_104285411 | 3300025911 | Corn Rhizosphere | MANREQRSNREKKKPKSDKKAVLMPVKTPAYVEPQLVRKPHKGKDWT |
| Ga0207703_100058445 | 3300026035 | Switchgrass Rhizosphere | MANREQRSNREKKKPKSDKKAVPMPVKTPAYVEPQLVRKPHKGKDWT |
| Ga0209522_10337812 | 3300027119 | Forest Soil | MANREQRGNKEKKKPKAEQKGAVSTAKQPAYVEPQLVRKPHKGKDWT |
| Ga0209222_10029715 | 3300027559 | Forest Soil | MANREQKSNREKKKPKASDKAKSPTAAQPAYVMPELVRKPHKGKPPG |
| Ga0209499_11730912 | 3300027712 | Freshwater Lake | MANREQKNSREKKKPKADKKAAPVSAKPGFAEPALIRKPHKGKDWS |
| Ga0209060_100329345 | 3300027826 | Surface Soil | MANREQRGNKEKKKPKADKKSAPAPVKAPAYVEPQLVRKPHKGKDWT |
| Ga0209580_104294701 | 3300027842 | Surface Soil | MANREQRGNKEKKKPKADKKIAPIAAKPPAYIEPQLVRKPHKGKQEF |
| Ga0209168_101652641 | 3300027986 | Surface Soil | NCLSGRAAMANREQRGNKEKKKPKADKKIAPIAAKPPAYIEPQLVRKPHKGKQEF |
| Ga0265337_11206222 | 3300028556 | Rhizosphere | MANREQRGNKEKKKPKADKKAGAAPTAIKPPAYVEPQLVRKPHKGKDWT |
| Ga0302201_100960302 | 3300028785 | Bog | MANREQKSSREKKKPKADKKAVPVMAKPAFAEPALIRKPHKGKDWT |
| Ga0302189_100759863 | 3300028788 | Bog | MANREQKSSREKKKPKADKKAVPVMAKPAFAEPALI |
| Ga0265338_109108002 | 3300028800 | Rhizosphere | MANREQKSNREKKKPKADKKGAAPVTTIKPPAYVEPQLVRKPHKGKDWT |
| Ga0311363_110090672 | 3300029922 | Fen | REKKKPKADKKAVPVMAKPAFAEPALIRKPHKGKDWT |
| Ga0311371_109086322 | 3300029951 | Palsa | VANREQKSNREKKKPKAGAKTPPVAAKPAFAEPALVRKPHKGKD |
| Ga0311344_106602342 | 3300030020 | Bog | MANREQKSNREKKKPKADKKLAPVQAKPAFPEPALVRKPHKGRDQT |
| Ga0311370_109965433 | 3300030503 | Palsa | MANREQKSSREKKKPKADKKAAPIQVSAKPAFQEPALIRKPHKGKDWT |
| Ga0311356_112249803 | 3300030617 | Palsa | VANREQKNNREKKKPKAGAKTAPVTAKPAFAEPAMVRK |
| Ga0302324_1027314922 | 3300031236 | Palsa | MANREQKSNREKKKPKADKNAQIQPAKAPAYIQPELVRKPHKGKQDY |
| Ga0265320_100006856 | 3300031240 | Rhizosphere | MANREQRGNKEKKKPKADKKAGPAPAGGIKPPAYVEPQLVRKPHKGKDWT |
| Ga0265320_104818682 | 3300031240 | Rhizosphere | MANREQRGNKEKKKPKADKKGAPVTTGVKPPAYVEPQLVRKPHKGKDWT |
| Ga0265340_100137666 | 3300031247 | Rhizosphere | MANREQRGNKEKKKPKSDKKAPVPAGGVKPPAYVEPQLVRKPHKGKDWT |
| Ga0265339_100867951 | 3300031249 | Rhizosphere | MANREQRGNKEKKKPKQDPKAKPGQTAIKPPAYVEPQLVRKPHKGKDWT |
| Ga0310686_1044966441 | 3300031708 | Soil | NLNQEGHVANREQKSNREKKKPKAGGKTPPVAAKPAFAEPALVRKPHKGKDWS |
| Ga0265314_100932432 | 3300031711 | Rhizosphere | MANREQRGNKEKKKPKSDKKAPAVPATGSKPPAYVEPQLVRKPHKGKDWT |
| Ga0265314_107180841 | 3300031711 | Rhizosphere | NREQKSNREKKKPKADKKGAAPVTTIKPPAYVEPQLVRKPHKGKDWT |
| Ga0310813_100159694 | 3300031716 | Soil | VANREQRSNKEKKKPKADKKGAQVVKTVSPTYVEPILVRKPHKGRGE |
| Ga0310813_102087842 | 3300031716 | Soil | MANREQRSNKEKRKPKADKKAAPVTVKQPGYVEPQLIRKPHKGKDWT |
| Ga0310813_103012012 | 3300031716 | Soil | MANREQRSNREKKKPKAEKKGVQGKSATPAYVEPALVRKPHKGKGEG |
| Ga0307469_106911052 | 3300031720 | Hardwood Forest Soil | MANREQRSNREKKKPKADKKAAPPIPAVKPPAYVEPQLIRKPHKGKDWV |
| Ga0307468_1023480551 | 3300031740 | Hardwood Forest Soil | MANREQRGNKEKKKPKADKKIAPITAKPPAYVEPQLVRKPHKGKDWT |
| Ga0316219_100049345 | 3300031759 | Freshwater | MANREQKNSREKKKPKADKKAAPAAAKPAFAEPALIRKPHKGKDWS |
| Ga0335080_101364671 | 3300032828 | Soil | MANREQRSNREKKKPKADKKAAPITAKAPAYVEPQLVRKPHKG |
| Ga0335070_100995673 | 3300032829 | Soil | MANREQRSNREKKKPKADKKAPPVTTTMKQPAYVEPQLIRKPHKGKDWT |
| Ga0310810_101942414 | 3300033412 | Soil | MANREQRGNKEKKKPKADKKAAQATTTFKTPAYVEPQLIRKPHKGKDWT |
| Ga0310811_100191293 | 3300033475 | Soil | MANREQRGNKEKKKPKADKKAGAASAVKQPAYVEPQLVRKPHKGKDWT |
| ⦗Top⦘ |