


| Basic Information | |
|---|---|
| Family ID | F090585 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MDPYYKKMMLWLAAAFVASIVAAVIIVELVIRKYGP |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.56 % |
| % of genes near scaffold ends (potentially truncated) | 12.04 % |
| % of genes from short scaffolds (< 2000 bps) | 85.19 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.037 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.148 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF05193 | Peptidase_M16_C | 25.93 |
| PF00474 | SSF | 25.93 |
| PF00072 | Response_reg | 6.48 |
| PF01145 | Band_7 | 1.85 |
| PF02410 | RsfS | 0.93 |
| PF02439 | Adeno_E3_CR2 | 0.93 |
| PF03847 | TFIID_20kDa | 0.93 |
| PF03544 | TonB_C | 0.93 |
| PF00271 | Helicase_C | 0.93 |
| PF13540 | RCC1_2 | 0.93 |
| PF01841 | Transglut_core | 0.93 |
| PF00350 | Dynamin_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.22 % |
| Unclassified | root | N/A | 2.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918006|ConsensusfromContig37427 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 2170459019|G14TP7Y02I41RS | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 2199352024|deeps__Contig_152722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300000956|JGI10216J12902_103112716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300000956|JGI10216J12902_103398788 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300000956|JGI10216J12902_103749502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300000956|JGI10216J12902_119093050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2094 | Open in IMG/M |
| 3300000956|JGI10216J12902_125599917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1277 | Open in IMG/M |
| 3300005293|Ga0065715_10037791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300005332|Ga0066388_104965712 | Not Available | 676 | Open in IMG/M |
| 3300005543|Ga0070672_100025062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4418 | Open in IMG/M |
| 3300005617|Ga0068859_100228907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1947 | Open in IMG/M |
| 3300005713|Ga0066905_100634068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300005764|Ga0066903_100021343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6918 | Open in IMG/M |
| 3300005980|Ga0066798_10140115 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006031|Ga0066651_10694702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300006196|Ga0075422_10485916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300006196|Ga0075422_10552042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006755|Ga0079222_10439192 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300006791|Ga0066653_10738866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300006800|Ga0066660_10888026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006845|Ga0075421_100723642 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300006853|Ga0075420_101536285 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006880|Ga0075429_101376410 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006880|Ga0075429_101715358 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300007004|Ga0079218_11041588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300007004|Ga0079218_13382512 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300007076|Ga0075435_101636527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300007255|Ga0099791_10307867 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300009029|Ga0066793_10595206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300009088|Ga0099830_10889627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300009094|Ga0111539_10217497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2225 | Open in IMG/M |
| 3300009094|Ga0111539_10506328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300009094|Ga0111539_11965225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300009148|Ga0105243_11407363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300009156|Ga0111538_11954292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300009162|Ga0075423_10359222 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300009553|Ga0105249_11531531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300009610|Ga0105340_1108562 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300009789|Ga0126307_10153751 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300009789|Ga0126307_10572094 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300010046|Ga0126384_10650553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300010362|Ga0126377_10054049 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
| 3300010397|Ga0134124_10766929 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300011269|Ga0137392_11239322 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300011398|Ga0137348_1084544 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300011424|Ga0137439_1076733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300011432|Ga0137428_1113176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012092|Ga0136621_1062834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1521 | Open in IMG/M |
| 3300012204|Ga0137374_10067037 | All Organisms → cellular organisms → Bacteria | 3558 | Open in IMG/M |
| 3300012204|Ga0137374_10525477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300012208|Ga0137376_11456503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012210|Ga0137378_11781058 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012212|Ga0150985_106055467 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300012228|Ga0137459_1017584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1992 | Open in IMG/M |
| 3300012350|Ga0137372_10872537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300012680|Ga0136612_10041752 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300012684|Ga0136614_10192724 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300012892|Ga0157294_10027459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
| 3300012895|Ga0157309_10173990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300012909|Ga0157290_10200196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012916|Ga0157310_10568465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300013765|Ga0120172_1066330 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300014326|Ga0157380_12639266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300015197|Ga0167638_1076321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300015251|Ga0180070_1016504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300015371|Ga0132258_11085769 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300015372|Ga0132256_102471591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300015372|Ga0132256_102546686 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300017965|Ga0190266_10128306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300018073|Ga0184624_10024303 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300018084|Ga0184629_10213128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300018429|Ga0190272_13162692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300018432|Ga0190275_10373438 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300018432|Ga0190275_12480167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300018469|Ga0190270_10026963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3672 | Open in IMG/M |
| 3300018476|Ga0190274_13707245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018481|Ga0190271_10419800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300018481|Ga0190271_11174552 | Not Available | 890 | Open in IMG/M |
| 3300019361|Ga0173482_10146674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300019868|Ga0193720_1013425 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300020009|Ga0193740_1018927 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300021082|Ga0210380_10331877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300022756|Ga0222622_10157394 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300025315|Ga0207697_10016284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3062 | Open in IMG/M |
| 3300025321|Ga0207656_10291354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300025893|Ga0207682_10094861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300025905|Ga0207685_10158874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1030 | Open in IMG/M |
| 3300025910|Ga0207684_10668017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300025923|Ga0207681_11224058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300025937|Ga0207669_11707805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300025945|Ga0207679_10499903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300025945|Ga0207679_11706054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026078|Ga0207702_12273474 | Not Available | 530 | Open in IMG/M |
| 3300026089|Ga0207648_10354655 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300026223|Ga0209840_1094321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300026319|Ga0209647_1017033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4617 | Open in IMG/M |
| 3300027682|Ga0209971_1126922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300027907|Ga0207428_10308848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300028380|Ga0268265_11105369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300028778|Ga0307288_10127816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300031455|Ga0307505_10016248 | All Organisms → cellular organisms → Bacteria | 3535 | Open in IMG/M |
| 3300031547|Ga0310887_10289824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300031562|Ga0310886_10408829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300031852|Ga0307410_11003121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300032002|Ga0307416_100810643 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300032163|Ga0315281_11203101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300033412|Ga0310810_10003491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17142 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.41% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.56% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_C_00766040 | 2140918006 | Soil | MDPQYKKMMLWLAAAFFGSIVAALIIVELVMRKYGP |
| 4MG_00446510 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VDPYYKKMMIAIGIALVASIVAAIIIVEIVIRKYGS |
| deeps_02805510 | 2199352024 | Soil | MAIDPYYRKMMIWLTAAFIASILAAIVIVELVIRKYG |
| JGI10216J12902_1031127162 | 3300000956 | Soil | VDSEYKKMMLWLTAAFIASVAAAFIIVEIVMRYYAES* |
| JGI10216J12902_1033987882 | 3300000956 | Soil | VDPYYKKMMIAIGIALIGSIVAAIIIVEIVIRKYGS* |
| JGI10216J12902_1037495021 | 3300000956 | Soil | MVGMDPEYKKMMLWLAAALIGSVAAAFIIVELMMRTYGRS* |
| JGI10216J12902_1190930503 | 3300000956 | Soil | VSIDRDYKKIMLWLTAAFIASVVAAFIIVELVMRHYAEP* |
| JGI10216J12902_1255999174 | 3300000956 | Soil | MATDPEYKKMMLWLAAAFVASVTAAFIIVEIVMRYYAD* |
| Ga0065715_100377911 | 3300005293 | Miscanthus Rhizosphere | AMAVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS* |
| Ga0066388_1049657121 | 3300005332 | Tropical Forest Soil | NTGIMDPYYRKMMIWLAVAFVAVVVAALIIVDVMMRKYGP* |
| Ga0070672_1000250624 | 3300005543 | Miscanthus Rhizosphere | MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGSP* |
| Ga0068859_1002289072 | 3300005617 | Switchgrass Rhizosphere | MDPYYKKMMLWLAAVFVASVAAALVIVELVMRKYGP* |
| Ga0066905_1006340682 | 3300005713 | Tropical Forest Soil | MDPYYRKMMIWLAVALVTCVVAALIIVEIMMRTYGP* |
| Ga0066903_1000213434 | 3300005764 | Tropical Forest Soil | MDPYYRKMMIWLAVALVTCVVAALIIVNIMMRTYGP* |
| Ga0066798_101401152 | 3300005980 | Soil | MDPQYKKMMLWLAAAFFGSIVAALIIVELVMRKYGP* |
| Ga0066651_106947022 | 3300006031 | Soil | MDPYYKKMMLWVAAAFVASIVAAVIIVELVIRHYGP* |
| Ga0075422_104859161 | 3300006196 | Populus Rhizosphere | AMDPEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP* |
| Ga0075422_105520422 | 3300006196 | Populus Rhizosphere | MDPQYRKMMLWLAAAFIASVAAAFIIVEIVMRYYAEP* |
| Ga0079222_104391923 | 3300006755 | Agricultural Soil | MDPYYRKMMIWLAAAFIASVVAAFIIVEIVMRYFAES* |
| Ga0066653_107388662 | 3300006791 | Soil | LIDPYYKKMMLWLAAAFVASILAAIVVVEIVMRKFGP* |
| Ga0066660_108880261 | 3300006800 | Soil | MDQYYKKMVLWLAALFAASLAAAAIIVELVIRRYGQ* |
| Ga0075421_1007236422 | 3300006845 | Populus Rhizosphere | MDPYYRKMMLWLAAAFVASIAAAIVIVEIMMRRYAG* |
| Ga0075420_1015362851 | 3300006853 | Populus Rhizosphere | VCATIGVCGMDPYYRKMMLWLAAAFVASIAAAIVIVEIMMRRYAG* |
| Ga0075429_1013764102 | 3300006880 | Populus Rhizosphere | MAMDPEYRKMMLWLTAAFVASVTAALIIVEIVMRYFGEP* |
| Ga0075429_1017153582 | 3300006880 | Populus Rhizosphere | MDPEYKKMMLWLAAAFIACVVAAFVIVEIVMRTYAEP |
| Ga0079218_110415882 | 3300007004 | Agricultural Soil | MATDPEYKKMMLWLAAAFIASVVAALIIVEIVMRYYAES* |
| Ga0079218_133825122 | 3300007004 | Agricultural Soil | VVIDPYYKKMMLWLAAAFVATIVAALVIVELVIRRYGP* |
| Ga0075435_1016365271 | 3300007076 | Populus Rhizosphere | MDPYYKKMMLWVAAALVATVAAALIIVELVMRRYAQ* |
| Ga0099791_103078672 | 3300007255 | Vadose Zone Soil | MDPYYKKMMLWLAAAFVASIAAALVIVEIVMRRYAP* |
| Ga0066793_105952062 | 3300009029 | Prmafrost Soil | MDPEYKKMMLWLAAAFFGSIVAALIIVEFVMRKYGP* |
| Ga0099830_108896272 | 3300009088 | Vadose Zone Soil | MDPYYKKMMLWLAAAFVASIAAALVIVELVIRRFAP* |
| Ga0111539_102174972 | 3300009094 | Populus Rhizosphere | MDPYYKKMMLWLAAAFVASIVAALIVVELVIRKYGGG* |
| Ga0111539_105063282 | 3300009094 | Populus Rhizosphere | MDPYYKKMMLWLAAAFIASIVAAIIVVEIVTRKYGP* |
| Ga0111539_119652252 | 3300009094 | Populus Rhizosphere | MAMDPEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP* |
| Ga0105243_114073632 | 3300009148 | Miscanthus Rhizosphere | MAVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS* |
| Ga0111538_119542922 | 3300009156 | Populus Rhizosphere | VIDPYYKKMMWWLAAAFVATVAAALVIVELVIRKYGP* |
| Ga0075423_103592222 | 3300009162 | Populus Rhizosphere | MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGP* |
| Ga0105249_115315312 | 3300009553 | Switchgrass Rhizosphere | MDPYYRKMMLWLAAAFVASIAAALIAVELVIRKYGGE* |
| Ga0105340_11085622 | 3300009610 | Soil | MDPYYKKMMLWLAAAFVASIVAAFIVVELVIRKYGGG* |
| Ga0126307_101537512 | 3300009789 | Serpentine Soil | MDPYYRKMMLWLAAAFVASIVAAIIIVELVIRRYGP* |
| Ga0126307_105720942 | 3300009789 | Serpentine Soil | VTPVSIDRDYKKIMLWLAAAFIASVVAAFIIVELVMRHYAAP* |
| Ga0126384_106505532 | 3300010046 | Tropical Forest Soil | MDPYYRKMMIWLAVALVTCVVAALIVVEIMMRTYGP* |
| Ga0126377_100540493 | 3300010362 | Tropical Forest Soil | MDPYYRKMMIWLAVAFVAVVVAALIIVNVMMRKYGP* |
| Ga0134124_107669292 | 3300010397 | Terrestrial Soil | MDPEYKKMMLWLAAALAGSIAAALLVVQLVIRRYGS* |
| Ga0137392_112393222 | 3300011269 | Vadose Zone Soil | MDPYYKKMMLWLAAAFVASILAALVIVEVVMRRYAP* |
| Ga0137348_10845442 | 3300011398 | Soil | MSIDRDYKKLMLWLAAAFIATIVAAVIIVELVMRHYAE* |
| Ga0137439_10767332 | 3300011424 | Soil | MDPYYKKMMLWLAAAFVASIVAALIAVELVIRKYGGS* |
| Ga0137428_11131762 | 3300011432 | Soil | MDPYYKKMMLWLAAAFVASVAAAIVIVEIVTRKYGP* |
| Ga0136621_10628343 | 3300012092 | Polar Desert Sand | MDPYYKKMMLWLAAAFVATIVAALVIVELILRRYPE* |
| Ga0137374_100670375 | 3300012204 | Vadose Zone Soil | MDAQYKKMMLWVAAAFIASILAALVIVELVIRKYGS* |
| Ga0137374_105254772 | 3300012204 | Vadose Zone Soil | MDPYYKKMMLWLAAAFVVSVIAALIVVELVIRKYGGS* |
| Ga0137376_114565032 | 3300012208 | Vadose Zone Soil | MVGMDPEYKKMMLWLAAALIGSVAAAFVIVELVMRTYGQS* |
| Ga0137378_117810582 | 3300012210 | Vadose Zone Soil | MDPYYKKMMLWLAAAFVASVAAALLIVELVIRKYGS* |
| Ga0150985_1060554673 | 3300012212 | Avena Fatua Rhizosphere | MDSYYKKMMIWLAVALVGTIVAALIIVQLVLRKYGP* |
| Ga0137459_10175842 | 3300012228 | Soil | MSFDRDYKKLMLWLAAAFIATVVAAVIIVELVMRHYAE* |
| Ga0137372_108725371 | 3300012350 | Vadose Zone Soil | MDPYYKKMMLWLAAVFVASIAAAAIIVEFVIRRFGP* |
| Ga0136612_100417522 | 3300012680 | Polar Desert Sand | MDPYYRKMMLWLAAAFVASVVAALIIVEIVMRRYAP* |
| Ga0136614_101927242 | 3300012684 | Polar Desert Sand | MDPYYKKMMLWLAAAFVASIAAAIVIVELVIRRYGL* |
| Ga0157294_100274593 | 3300012892 | Soil | VDPYYKKMMIAIGIALVASIVAAIIIVEIVIRKYGS* |
| Ga0157309_101739902 | 3300012895 | Soil | MDSYYKKMMVWLAVAFFGSIVAAIIIVEFVMRKYGPP* |
| Ga0157290_102001962 | 3300012909 | Soil | VIDPYYKKMMWWLAAAFVASIAAALVIVELVMRKFGP* |
| Ga0157310_105684652 | 3300012916 | Soil | VIDPYYKKMMWWLAAAFVASIVAALIAVELVIRKYGGG* |
| Ga0120172_10663302 | 3300013765 | Permafrost | MDPYYKKMMLWLAAAFIASVAAAIVIVELVIRKYGP* |
| Ga0157380_126392662 | 3300014326 | Switchgrass Rhizosphere | MDPYYKKMMLWLAAAFVASIVAALIVVEIVIRKYGGG* |
| Ga0167638_10763212 | 3300015197 | Glacier Forefield Soil | MDREYKKMMLWLLAVFVASVVAAFVIVELVLRHWGPA* |
| Ga0180070_10165042 | 3300015251 | Soil | MDPYYRKMMVWLAAAFVASVVAAFVIVELVIRRYAE* |
| Ga0132258_110857692 | 3300015371 | Arabidopsis Rhizosphere | MDPYYKKMMLWLAAAFVASIVAALIAVELVIRKYGGG* |
| Ga0132256_1024715912 | 3300015372 | Arabidopsis Rhizosphere | MDPYYKKMMLWLAAALFASIAAAFLVVELVIRKYGSR* |
| Ga0132256_1025466862 | 3300015372 | Arabidopsis Rhizosphere | MSVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS* |
| Ga0190266_101283062 | 3300017965 | Soil | MDPYYKKMMLWLAAAFIASIVAAIIVVEIVTRKYGP |
| Ga0184624_100243032 | 3300018073 | Groundwater Sediment | MDPYYKKMMLWVAAAFVASIVAAVIIVELVIRHYGP |
| Ga0184629_102131282 | 3300018084 | Groundwater Sediment | MDPYYKKMMLWLAAAFVASIAAALVIVEIVMKRYAP |
| Ga0190272_131626922 | 3300018429 | Soil | MDPYYKKMMLWVAAAFVASIVAALIIVELVIRKYGP |
| Ga0190275_103734382 | 3300018432 | Soil | MSIDRDYKKIMWWLAAAFIATVIAAFIIVELIMRHYAPE |
| Ga0190275_124801671 | 3300018432 | Soil | MDPYYKKMMLWLAAAFIATILAALVIVELVLRRYPEQ |
| Ga0190270_100269632 | 3300018469 | Soil | MSIDRDYKKLMLWLAAAFIATVVAAVIIVELVMRHYGE |
| Ga0190274_137072451 | 3300018476 | Soil | VIDPYYKKMMWWLAAAFVASIAAALVIVELVMRKFGP |
| Ga0190271_104198002 | 3300018481 | Soil | VIDPYYKKMMWWLAAAFVASIAAALVIVELVIRKFGP |
| Ga0190271_111745522 | 3300018481 | Soil | DPYYKKMMWWLAAAFVASIAAAIVIVELVIRRYGP |
| Ga0173482_101466742 | 3300019361 | Soil | MDSYYKKMMVWLAVAFFGSIVAAIIIVEFVMRKYGPP |
| Ga0193720_10134252 | 3300019868 | Soil | MDREYKKMMLWLAAALFGSVAAAFIIVEFMMRKYGQG |
| Ga0193740_10189273 | 3300020009 | Soil | MSIDRDYKKLMLWLAAAFIASVVAAVIIVELVMRHYAEP |
| Ga0210380_103318772 | 3300021082 | Groundwater Sediment | MDPYYKKMMLWVAAAFVASIVAAVIIVELVIRKYGGG |
| Ga0222622_101573942 | 3300022756 | Groundwater Sediment | MDPYYKKMMLWLAAVFVASVVAALAIVELVMRQYGP |
| Ga0207697_100162843 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGSP |
| Ga0207656_102913542 | 3300025321 | Corn Rhizosphere | MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGS |
| Ga0207682_100948612 | 3300025893 | Miscanthus Rhizosphere | MAVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS |
| Ga0207685_101588743 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSYYKKMMVWLAIAFIGSIVAALVIVELVMRKYGP |
| Ga0207684_106680172 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPYYKKMMLWLAAVFVASVAAALVIVELVMRKYGP |
| Ga0207681_112240582 | 3300025923 | Switchgrass Rhizosphere | MDPYYKKMMLWLAAAFVASIVAALIAVELVIRKYGGG |
| Ga0207669_117078052 | 3300025937 | Miscanthus Rhizosphere | MDPYYKKMMLWLAAAFVASIVAAVIIVELVIRKYGP |
| Ga0207679_104999032 | 3300025945 | Corn Rhizosphere | MDPYYKKMMLWPAAVFVASVAAALVIVELVMRKYGP |
| Ga0207679_117060542 | 3300025945 | Corn Rhizosphere | HTRMDPEYKKMMLWLAAALAGSIAAALLVVQLVIRRYGS |
| Ga0207702_122734742 | 3300026078 | Corn Rhizosphere | MDPYYKKMMLWLAAVLFASIGAAFILVEYVIRKYGS |
| Ga0207648_103546553 | 3300026089 | Miscanthus Rhizosphere | MDPYYKKMMLWLAAAFVATIVAALIIVELVMRRYAQ |
| Ga0209840_10943212 | 3300026223 | Soil | GLKAGHGRSMDPQYKKMMLWLAAAFFGSIVAALIIVELVMRKYGP |
| Ga0209647_10170332 | 3300026319 | Grasslands Soil | MDPYYKKMMLWLAAVFVASIVAALVVVEIVIRRYAP |
| Ga0209971_11269222 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MSVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS |
| Ga0207428_103088482 | 3300027907 | Populus Rhizosphere | MDPYYKKMMLWLAAAFVASIVAALIVVELVIRKYGGG |
| Ga0268265_111053692 | 3300028380 | Switchgrass Rhizosphere | MDPYYRKMMLWLAAAFVASIAAALIAVELVIRKYGGE |
| Ga0307288_101278162 | 3300028778 | Soil | LIDPYYKKMMLWLAAAFVASVAAAILIVELVMRKFGP |
| Ga0307505_100162483 | 3300031455 | Soil | MIDPYYKKMMLWLAAAFVATIIAALVIVELVLRRYPE |
| Ga0310887_102898242 | 3300031547 | Soil | MAMDPEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP |
| Ga0310886_104088292 | 3300031562 | Soil | PEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP |
| Ga0307410_110031211 | 3300031852 | Rhizosphere | MAMDPEYKKMMLWLTAAFIASVAAAFIIVEIVMRYYAES |
| Ga0307416_1008106432 | 3300032002 | Rhizosphere | MDPYYKKMMIWLGVAFVASIVAAIIIVEIIVRRYGP |
| Ga0315281_112031012 | 3300032163 | Sediment | MDPYYKKMMLWLAAAFVASVAAAIVIVELVIRRYGP |
| Ga0310810_1000349113 | 3300033412 | Soil | MDPYYKKMMLWLAAALFASIAAAFLVVELVIRKYGSR |
| ⦗Top⦘ |