


| Basic Information | |
|---|---|
| Family ID | F090552 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKRVIIFALVLLGALAPVAGVAEAHWDSACQCDEVEAP |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.52 % |
| % of genes near scaffold ends (potentially truncated) | 23.15 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.630 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.926 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 8.33 |
| PF06912 | DUF1275 | 7.41 |
| PF00528 | BPD_transp_1 | 5.56 |
| PF12911 | OppC_N | 3.70 |
| PF00072 | Response_reg | 2.78 |
| PF01734 | Patatin | 2.78 |
| PF02738 | MoCoBD_1 | 2.78 |
| PF13458 | Peripla_BP_6 | 1.85 |
| PF04909 | Amidohydro_2 | 1.85 |
| PF01266 | DAO | 1.85 |
| PF07366 | SnoaL | 1.85 |
| PF11066 | DUF2867 | 0.93 |
| PF00873 | ACR_tran | 0.93 |
| PF00583 | Acetyltransf_1 | 0.93 |
| PF14417 | MEDS | 0.93 |
| PF13602 | ADH_zinc_N_2 | 0.93 |
| PF00507 | Oxidored_q4 | 0.93 |
| PF16576 | HlyD_D23 | 0.93 |
| PF00041 | fn3 | 0.93 |
| PF07758 | DUF1614 | 0.93 |
| PF00248 | Aldo_ket_red | 0.93 |
| PF01970 | TctA | 0.93 |
| PF02417 | Chromate_transp | 0.93 |
| PF00296 | Bac_luciferase | 0.93 |
| PF02321 | OEP | 0.93 |
| PF03972 | MmgE_PrpD | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF08240 | ADH_N | 0.93 |
| PF13365 | Trypsin_2 | 0.93 |
| PF02653 | BPD_transp_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 8.33 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 7.41 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 2.78 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 2.78 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 2.78 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.93 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.93 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.93 |
| COG4089 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.63 % |
| Unclassified | root | N/A | 20.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0601779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0871407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1123 | Open in IMG/M |
| 3300000559|F14TC_103211562 | Not Available | 1073 | Open in IMG/M |
| 3300000955|JGI1027J12803_104581615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1774 | Open in IMG/M |
| 3300001431|F14TB_101468908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
| 3300002908|JGI25382J43887_10016204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3901 | Open in IMG/M |
| 3300005167|Ga0066672_10238484 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1168 | Open in IMG/M |
| 3300005167|Ga0066672_10532914 | Not Available | 761 | Open in IMG/M |
| 3300005171|Ga0066677_10034644 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300005171|Ga0066677_10172890 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300005177|Ga0066690_10033227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 3019 | Open in IMG/M |
| 3300005186|Ga0066676_10556143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 778 | Open in IMG/M |
| 3300005332|Ga0066388_106604977 | Not Available | 584 | Open in IMG/M |
| 3300005336|Ga0070680_101715445 | Not Available | 544 | Open in IMG/M |
| 3300005445|Ga0070708_101395643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfolunaceae → Desulfoluna → Desulfoluna butyratoxydans | 653 | Open in IMG/M |
| 3300005446|Ga0066686_10420793 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005467|Ga0070706_100025641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 5426 | Open in IMG/M |
| 3300005467|Ga0070706_100960680 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005467|Ga0070706_101099908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
| 3300005467|Ga0070706_101506133 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
| 3300005536|Ga0070697_100689933 | Not Available | 901 | Open in IMG/M |
| 3300005540|Ga0066697_10119716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1543 | Open in IMG/M |
| 3300005561|Ga0066699_10099650 | Not Available | 1913 | Open in IMG/M |
| 3300005719|Ga0068861_100394571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1226 | Open in IMG/M |
| 3300006049|Ga0075417_10057377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1697 | Open in IMG/M |
| 3300006049|Ga0075417_10287123 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006237|Ga0097621_100099601 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300006800|Ga0066660_10253234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1378 | Open in IMG/M |
| 3300006800|Ga0066660_10373069 | Not Available | 1167 | Open in IMG/M |
| 3300006844|Ga0075428_100928083 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300006844|Ga0075428_101867564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300006845|Ga0075421_100059433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4833 | Open in IMG/M |
| 3300006847|Ga0075431_101647605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
| 3300006852|Ga0075433_10376445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1254 | Open in IMG/M |
| 3300006854|Ga0075425_100925980 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300006871|Ga0075434_100230036 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300007076|Ga0075435_100183349 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300007258|Ga0099793_10074912 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300009012|Ga0066710_100559469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1731 | Open in IMG/M |
| 3300009094|Ga0111539_11665884 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009100|Ga0075418_10278506 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300009137|Ga0066709_100067211 | All Organisms → cellular organisms → Bacteria | 4184 | Open in IMG/M |
| 3300009137|Ga0066709_102955140 | Not Available | 625 | Open in IMG/M |
| 3300009143|Ga0099792_10205608 | Not Available | 1123 | Open in IMG/M |
| 3300009147|Ga0114129_10002283 | All Organisms → cellular organisms → Bacteria | 26550 | Open in IMG/M |
| 3300009147|Ga0114129_10599571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
| 3300009176|Ga0105242_10577169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1082 | Open in IMG/M |
| 3300009837|Ga0105058_1102085 | Not Available | 674 | Open in IMG/M |
| 3300009837|Ga0105058_1181428 | Not Available | 521 | Open in IMG/M |
| 3300010124|Ga0127498_1121476 | Not Available | 604 | Open in IMG/M |
| 3300010358|Ga0126370_10847268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300010360|Ga0126372_10008360 | All Organisms → cellular organisms → Bacteria | 5310 | Open in IMG/M |
| 3300012199|Ga0137383_10967816 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012202|Ga0137363_10096519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2236 | Open in IMG/M |
| 3300012203|Ga0137399_10066669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2684 | Open in IMG/M |
| 3300012205|Ga0137362_10037931 | All Organisms → cellular organisms → Bacteria | 3864 | Open in IMG/M |
| 3300012211|Ga0137377_10020040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5894 | Open in IMG/M |
| 3300012361|Ga0137360_10042827 | All Organisms → cellular organisms → Bacteria | 3220 | Open in IMG/M |
| 3300012390|Ga0134054_1067308 | Not Available | 520 | Open in IMG/M |
| 3300012410|Ga0134060_1291899 | Not Available | 789 | Open in IMG/M |
| 3300012685|Ga0137397_10006583 | All Organisms → cellular organisms → Bacteria | 8058 | Open in IMG/M |
| 3300012685|Ga0137397_10916981 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012918|Ga0137396_10001596 | All Organisms → cellular organisms → Bacteria | 12031 | Open in IMG/M |
| 3300012922|Ga0137394_10262279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1478 | Open in IMG/M |
| 3300012922|Ga0137394_10280174 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300012944|Ga0137410_11525903 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012975|Ga0134110_10153534 | Not Available | 952 | Open in IMG/M |
| 3300013297|Ga0157378_10159557 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300015371|Ga0132258_11023946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2087 | Open in IMG/M |
| 3300017792|Ga0163161_10835103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300020170|Ga0179594_10091747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1083 | Open in IMG/M |
| 3300025910|Ga0207684_10117844 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300025910|Ga0207684_10489827 | Not Available | 1054 | Open in IMG/M |
| 3300025922|Ga0207646_10078985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2942 | Open in IMG/M |
| 3300025922|Ga0207646_11736872 | Not Available | 535 | Open in IMG/M |
| 3300025934|Ga0207686_10468927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 972 | Open in IMG/M |
| 3300025972|Ga0207668_10388876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1176 | Open in IMG/M |
| 3300026118|Ga0207675_100554697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1148 | Open in IMG/M |
| 3300026297|Ga0209237_1080010 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300026309|Ga0209055_1002649 | All Organisms → cellular organisms → Bacteria | 11210 | Open in IMG/M |
| 3300026315|Ga0209686_1145139 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300026324|Ga0209470_1305562 | Not Available | 587 | Open in IMG/M |
| 3300026325|Ga0209152_10036952 | Not Available | 1686 | Open in IMG/M |
| 3300026332|Ga0209803_1074635 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300026469|Ga0257169_1075979 | Not Available | 546 | Open in IMG/M |
| 3300026537|Ga0209157_1235376 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300026540|Ga0209376_1418243 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027577|Ga0209874_1084348 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 774 | Open in IMG/M |
| 3300027873|Ga0209814_10341382 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300027903|Ga0209488_10320208 | Not Available | 1156 | Open in IMG/M |
| 3300027909|Ga0209382_10107090 | All Organisms → cellular organisms → Bacteria | 3270 | Open in IMG/M |
| 3300027909|Ga0209382_10499752 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300027909|Ga0209382_11467673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 681 | Open in IMG/M |
| 3300028536|Ga0137415_10028469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5505 | Open in IMG/M |
| 3300031720|Ga0307469_10068706 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300031720|Ga0307469_10126734 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300031720|Ga0307469_10841169 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300031720|Ga0307469_11786602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300031720|Ga0307469_12373256 | Not Available | 518 | Open in IMG/M |
| 3300031740|Ga0307468_100030852 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300031740|Ga0307468_100574735 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300031820|Ga0307473_10028709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2393 | Open in IMG/M |
| 3300031820|Ga0307473_10756979 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
| 3300032174|Ga0307470_10737195 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300032180|Ga0307471_100122808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2424 | Open in IMG/M |
| 3300032180|Ga0307471_101219036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 916 | Open in IMG/M |
| 3300032180|Ga0307471_101338670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 878 | Open in IMG/M |
| 3300032180|Ga0307471_103474101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 12.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_06017792 | 3300000033 | Soil | MKRIIMLALVLLGALAPVVVTSVAEAHWDDACQCNEIEAP* |
| ICChiseqgaiiDRAFT_08714072 | 3300000033 | Soil | MKRFMIFALVLLGALAPVAGVAHVAEAHWDNACQCNEVEAP* |
| F14TC_1032115622 | 3300000559 | Soil | MKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIESP* |
| JGI1027J12803_1045816151 | 3300000955 | Soil | MKRVIIFALVLLGALAPLAGVAEAHWDTACQCNDIEAP* |
| F14TB_1014689081 | 3300001431 | Soil | MKRIIMLALVLLGALAPVVVTSVAEAHWDDACQCNEIE |
| JGI25382J43887_100162044 | 3300002908 | Grasslands Soil | MKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP* |
| Ga0066672_102384842 | 3300005167 | Soil | VVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP* |
| Ga0066672_105329142 | 3300005167 | Soil | MKRVIMFALVLLGALAPVVVTSVAEAHWNDACQCNEVEAP* |
| Ga0066677_100346443 | 3300005171 | Soil | MRDLVSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP* |
| Ga0066677_101728902 | 3300005171 | Soil | VVRDERGEIKMKRAIIFAALVLLGALAPFASVAEAHWDDACQCNEVEAP* |
| Ga0066690_100332275 | 3300005177 | Soil | GGDQMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP* |
| Ga0066676_105561433 | 3300005186 | Soil | GRGEIKMKRVIIFALVLLGALAPFAGVAEAHWDNACQCNEVEAP* |
| Ga0066388_1066049773 | 3300005332 | Tropical Forest Soil | MKRFMIFTLVLLGALAPVVGVAHFAEAGWDTACQCNVVEAP* |
| Ga0070680_1017154451 | 3300005336 | Corn Rhizosphere | MKRVIMFALVLLAALAPAVVTSVAEAHWDDACHCNEIEAP |
| Ga0070708_1013956432 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDGRGEFKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0066686_104207931 | 3300005446 | Soil | VVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDDACQCNEVEAP* |
| Ga0070706_1000256416 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDLVSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0070706_1009606801 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0070706_1010999081 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVIMFALVLLGALAPVVVTSVAEAHWDDACQCNEVEAP* |
| Ga0070706_1015061332 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVIIFAALVLLGALAPVAGVAEAHPDTTCQCNEIEAP* |
| Ga0070697_1006899331 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0066697_101197162 | 3300005540 | Soil | MKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP* |
| Ga0066699_100996502 | 3300005561 | Soil | MKRVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP* |
| Ga0068861_1003945713 | 3300005719 | Switchgrass Rhizosphere | MMKRAIILALVLFGALAPMAGIADAHWDTACQCEEIESP* |
| Ga0075417_100573772 | 3300006049 | Populus Rhizosphere | MKRVIMFALVLLTALGPVAGLARVAEAHWDSACQCNETEAP* |
| Ga0075417_102871232 | 3300006049 | Populus Rhizosphere | MKRVMIMFALVLLGALAPVVGVAHVAEAHWDSACRCDATEAP* |
| Ga0097621_1000996014 | 3300006237 | Miscanthus Rhizosphere | VREKEGGEIKMKRVIMFALVLLAALAPAVVTSVAEAHWDDACHCNEIEAP* |
| Ga0066660_102532342 | 3300006800 | Soil | MRDLVSDRDGRGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP* |
| Ga0066660_103730691 | 3300006800 | Soil | DQMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP* |
| Ga0075428_1009280831 | 3300006844 | Populus Rhizosphere | MKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCDTLEAP* |
| Ga0075428_1018675642 | 3300006844 | Populus Rhizosphere | MKRVIMFALVLLAALGPVAGLARVAEAHWDSACQCNETEAP* |
| Ga0075421_1000594337 | 3300006845 | Populus Rhizosphere | MKRFIIFALVLLGALAPVAGVAHVAEAHWDSACQCDTLEAP* |
| Ga0075431_1016476051 | 3300006847 | Populus Rhizosphere | MKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQC |
| Ga0075433_103764451 | 3300006852 | Populus Rhizosphere | MKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP* |
| Ga0075425_1009259803 | 3300006854 | Populus Rhizosphere | MKRVIIFAALVLLGALAPVAGVAKAHPDTTCQCNEIEAP |
| Ga0075434_1002300361 | 3300006871 | Populus Rhizosphere | SVMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP* |
| Ga0075435_1001833491 | 3300007076 | Populus Rhizosphere | GVRSVMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP* |
| Ga0099793_100749121 | 3300007258 | Vadose Zone Soil | MRERRGEIKMKRVIIFALVLLGALAPVAGVAEAHWDSACQCNEVEAP* |
| Ga0066710_1005594692 | 3300009012 | Grasslands Soil | MKRVIIFALVLLGALAPVAGVAEAHWNDACQCNEVEAP |
| Ga0111539_116658841 | 3300009094 | Populus Rhizosphere | KRVIMFALVLLTALGPVAGLARVAEAHWDSACQCNETEAP* |
| Ga0075418_102785061 | 3300009100 | Populus Rhizosphere | MKRFMIFALVLLGALAPVAGVTHVAEAHWDSACQCE |
| Ga0066709_1000672112 | 3300009137 | Grasslands Soil | MKRVIIFALVLLGALAPVAGVAEAHWNDACQCNEVEAP* |
| Ga0066709_1029551401 | 3300009137 | Grasslands Soil | VVRDERGEIKMKRAIIFAALALLGALAPFAGVAEAHWVDACQCNEVEAP* |
| Ga0099792_102056082 | 3300009143 | Vadose Zone Soil | MKRVIIFFALVLLGALAPLAGVAEAHWDDACQCNEVEAP* |
| Ga0114129_1000228326 | 3300009147 | Populus Rhizosphere | MIMFALVLLGALAPVVGVAHVAEAHWDSACRCDATEAP* |
| Ga0114129_105995713 | 3300009147 | Populus Rhizosphere | MKRIIMLALVLLGALAPVVVTSVAEAQWDDACQCNEIEAP* |
| Ga0105242_105771693 | 3300009176 | Miscanthus Rhizosphere | MKRAIIFALVLLGALAPVVGVAQAHWDTACSCDEIESP* |
| Ga0105058_11020851 | 3300009837 | Groundwater Sand | MKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCDAVEAP* |
| Ga0105058_11814281 | 3300009837 | Groundwater Sand | MKKVIIFALVLFGALAPVVGVAEAHWDTACQCNEIE |
| Ga0127498_11214761 | 3300010124 | Grasslands Soil | RDLVSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0126370_108472681 | 3300010358 | Tropical Forest Soil | RFMIFTLVLLGALAPVVGVAHFAEAGWDTACQCNVVEAP* |
| Ga0126372_100083601 | 3300010360 | Tropical Forest Soil | NVEREVSQMKRFMIFTLVLLGALAPVVGVAHFAEAGWDTACQCNVVEAP* |
| Ga0137383_109678162 | 3300012199 | Vadose Zone Soil | VVRDERGEIKMKRAIIFAALALLGALAPFAGVAEAHWDDACQCNEVEAP* |
| Ga0137363_100965191 | 3300012202 | Vadose Zone Soil | MKRVIIFALVLLGALAPVVGVAEAHWDNACQCNEVEAP* |
| Ga0137399_100666692 | 3300012203 | Vadose Zone Soil | MRERRGEIKMKRVIIFALVLLGALAPVAGVAEAHWDSACQCDEVEAP* |
| Ga0137362_100379313 | 3300012205 | Vadose Zone Soil | MKRVIIFALVLLGALAPLAGVAEAHWDSACQCNEVEAP* |
| Ga0137377_100200405 | 3300012211 | Vadose Zone Soil | MKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0137360_100428273 | 3300012361 | Vadose Zone Soil | MKRVIIFALVLLGALAPLAGVAEAHWDSACQCNEV* |
| Ga0134054_10673081 | 3300012390 | Grasslands Soil | SDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0134060_12918991 | 3300012410 | Grasslands Soil | IDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP* |
| Ga0137397_100065834 | 3300012685 | Vadose Zone Soil | MKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCNEVEAP* |
| Ga0137397_109169812 | 3300012685 | Vadose Zone Soil | MMKRAMIFALVLLGALAPVVGVAEAHWDSACQCNEFESP* |
| Ga0137396_1000159616 | 3300012918 | Vadose Zone Soil | MRERRGEIKMKRVIIFALVLLGALAPVAGVAEAHWDSACQYDEVEAP* |
| Ga0137394_102622792 | 3300012922 | Vadose Zone Soil | MKRVIMFALVLLGALAPVVVTSVAEAHWDSACQCNEIEAP* |
| Ga0137394_102801742 | 3300012922 | Vadose Zone Soil | MKRAIIFAFLLLAALAPMVGVAEAYWDTACQCNEVEAP* |
| Ga0137410_115259031 | 3300012944 | Vadose Zone Soil | MMKRAIIFALVLLGALAPVVGVAEARWDDACQCNQIEAP* |
| Ga0134110_101535342 | 3300012975 | Grasslands Soil | MRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP* |
| Ga0157378_101595574 | 3300013297 | Miscanthus Rhizosphere | MMKRAIIFALVLFGALAPVVGVAEAHWDTTCECNEIEAP* |
| Ga0132258_110239461 | 3300015371 | Arabidopsis Rhizosphere | IILALVLFGALAPMAGIADAHWDTACQCEEIESP* |
| Ga0163161_108351031 | 3300017792 | Switchgrass Rhizosphere | MMKRAIILALVLFGALAPMASIADAHWDTACQCEEIESP |
| Ga0179594_100917471 | 3300020170 | Vadose Zone Soil | MKRVIIFALVLLGALAPLAGVAEAHWDSACQCNEVEAP |
| Ga0207684_101178443 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP |
| Ga0207684_104898271 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP |
| Ga0207646_100789855 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDETEAP |
| Ga0207646_117368721 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIIIFALVLLGAIAPVASVAEAHWDDACHCNEIEAPERRYSDLI |
| Ga0207686_104689273 | 3300025934 | Miscanthus Rhizosphere | MKRAIIFALVLLGALAPVVGVAQAHWDTACSCDEIESP |
| Ga0207668_103888762 | 3300025972 | Switchgrass Rhizosphere | MMKRAIILALVLFGALAPMAGIADAHWDTACQCEEIESP |
| Ga0207675_1005546972 | 3300026118 | Switchgrass Rhizosphere | MMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIESP |
| Ga0209237_10800101 | 3300026297 | Grasslands Soil | VVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP |
| Ga0209055_100264913 | 3300026309 | Soil | MKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP |
| Ga0209686_11451392 | 3300026315 | Soil | VVRDERGEIKMKRAIIFAALVLLGALAPFASVAEAHWDDACQCNEVEAP |
| Ga0209470_13055621 | 3300026324 | Soil | MKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVE |
| Ga0209152_100369523 | 3300026325 | Soil | MKRVIIFALVLLGALAPVASVAEAHWDDACHCDETEAP |
| Ga0209803_10746353 | 3300026332 | Soil | MRDGRGEFKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP |
| Ga0257169_10759792 | 3300026469 | Soil | MKRVIIFALVLLGALAPVVGVADAHWDDACQCNEVEAP |
| Ga0209157_12353762 | 3300026537 | Soil | VVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDDACQCNEVEAP |
| Ga0209376_14182432 | 3300026540 | Soil | VVRDERGEIKMKRAIIFAALVLLGALTPFAGVAEAHWDNACQCNEVEAP |
| Ga0209874_10843482 | 3300027577 | Groundwater Sand | MKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCDAVEAP |
| Ga0209814_103413821 | 3300027873 | Populus Rhizosphere | MKRVMIMFALVLLGALAPVVGVAHVAEAHWDSACRCDATEAP |
| Ga0209488_103202082 | 3300027903 | Vadose Zone Soil | MKRVIIFFALVLLGALAPLAGVAEAHWDDACQCNEVEAP |
| Ga0209382_101070902 | 3300027909 | Populus Rhizosphere | MKRVIMFALVILGALAPVVVTSVAEAHWDDACQCNEIEAP |
| Ga0209382_104997522 | 3300027909 | Populus Rhizosphere | MKRVIMFALVLLAALGPVAGLARVAEAHWDSACQCNETEAP |
| Ga0209382_114676731 | 3300027909 | Populus Rhizosphere | MKRFIIFALVLLGALAPVAGVAHVAEAHWDSACQCDTLEAP |
| Ga0137415_100284697 | 3300028536 | Vadose Zone Soil | MKRVIIFALVLLGALAPVAGVAEAHWDSACQCDEVEAP |
| Ga0307469_100687062 | 3300031720 | Hardwood Forest Soil | MKRFMIFALVLLGALAPVAAVTHVAEARWDSACQCNEVEAP |
| Ga0307469_101267342 | 3300031720 | Hardwood Forest Soil | MRETEIERGEIKMKRVIIFALVLLGALAPLAGVAEAHWDTACQCNDIEAP |
| Ga0307469_108411692 | 3300031720 | Hardwood Forest Soil | MMKRAIIFALVLFGALAPVVGIAEAHWDTTCQCNEIEAP |
| Ga0307469_117866021 | 3300031720 | Hardwood Forest Soil | MMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIEAP |
| Ga0307469_123732562 | 3300031720 | Hardwood Forest Soil | MMKRAIILALVLFGALAPMAGIADAHWDTACQCDEIESP |
| Ga0307468_1000308522 | 3300031740 | Hardwood Forest Soil | MMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP |
| Ga0307468_1005747352 | 3300031740 | Hardwood Forest Soil | VRERKKKEGGEIKMKRIIMLALVLFGALAPVVVTSVAEAHWDDACQCNEIEAP |
| Ga0307473_100287091 | 3300031820 | Hardwood Forest Soil | MKRVIIFALVLLGALAPLAGVAEAHWDTACQCNDIEAP |
| Ga0307473_107569791 | 3300031820 | Hardwood Forest Soil | PMMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIEAP |
| Ga0307470_107371952 | 3300032174 | Hardwood Forest Soil | MKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP |
| Ga0307471_1001228083 | 3300032180 | Hardwood Forest Soil | MKRFMIFALVLLGALAPVAGVVHVAEAHWDSACQCETFEAP |
| Ga0307471_1012190363 | 3300032180 | Hardwood Forest Soil | MKRFMIFALVLLGALAPVAGVVHVAEAHWDSSCQCDQVEAP |
| Ga0307471_1013386702 | 3300032180 | Hardwood Forest Soil | MKRVIMFALVLLGALAPVVVTSVAEAHWDDACQCNEVEAP |
| Ga0307471_1034741011 | 3300032180 | Hardwood Forest Soil | MKRVIVFALVLLGALAPVVVTSVAEAHWNDACQCNEVEAP |
| ⦗Top⦘ |