


| Basic Information | |
|---|---|
| Family ID | F090473 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDE |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.41 % |
| % of genes near scaffold ends (potentially truncated) | 93.52 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.593 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.482 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.593 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.926 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 0.00% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF09335 | SNARE_assoc | 2.78 |
| PF02239 | Cytochrom_D1 | 1.85 |
| PF02826 | 2-Hacid_dh_C | 1.85 |
| PF00005 | ABC_tran | 1.85 |
| PF00528 | BPD_transp_1 | 1.85 |
| PF00171 | Aldedh | 1.85 |
| PF03401 | TctC | 0.93 |
| PF04392 | ABC_sub_bind | 0.93 |
| PF01436 | NHL | 0.93 |
| PF01329 | Pterin_4a | 0.93 |
| PF04430 | DUF498 | 0.93 |
| PF00903 | Glyoxalase | 0.93 |
| PF03601 | Cons_hypoth698 | 0.93 |
| PF00486 | Trans_reg_C | 0.93 |
| PF07007 | LprI | 0.93 |
| PF01609 | DDE_Tnp_1 | 0.93 |
| PF00211 | Guanylate_cyc | 0.93 |
| PF02129 | Peptidase_S15 | 0.93 |
| PF00589 | Phage_integrase | 0.93 |
| PF00580 | UvrD-helicase | 0.93 |
| PF01135 | PCMT | 0.93 |
| PF00239 | Resolvase | 0.93 |
| PF13416 | SBP_bac_8 | 0.93 |
| PF14534 | DUF4440 | 0.93 |
| PF04073 | tRNA_edit | 0.93 |
| PF03006 | HlyIII | 0.93 |
| PF08530 | PepX_C | 0.93 |
| PF01425 | Amidase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.78 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.78 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.85 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.85 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.85 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.93 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.93 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.93 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.93 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.93 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.93 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.93 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.93 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.93 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.93 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.93 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.93 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.93 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.93 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.93 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.93 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.59 % |
| Unclassified | root | N/A | 32.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005947|Ga0066794_10258380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005980|Ga0066798_10127647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300006354|Ga0075021_10523515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300006854|Ga0075425_101991166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300009038|Ga0099829_10332489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300009089|Ga0099828_11948353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 515 | Open in IMG/M |
| 3300009522|Ga0116218_1257957 | Not Available | 783 | Open in IMG/M |
| 3300009632|Ga0116102_1186616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300009698|Ga0116216_10436887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300009760|Ga0116131_1079955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300009792|Ga0126374_10637604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300010047|Ga0126382_11290371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300010048|Ga0126373_12953815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300010358|Ga0126370_11549164 | Not Available | 632 | Open in IMG/M |
| 3300010360|Ga0126372_10347813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1328 | Open in IMG/M |
| 3300010360|Ga0126372_11042967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
| 3300010361|Ga0126378_11328117 | Not Available | 813 | Open in IMG/M |
| 3300010366|Ga0126379_12649196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300010366|Ga0126379_12868756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010376|Ga0126381_103175049 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010379|Ga0136449_102510746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300010379|Ga0136449_102995793 | Not Available | 660 | Open in IMG/M |
| 3300010398|Ga0126383_13284524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300012202|Ga0137363_10090138 | Not Available | 2307 | Open in IMG/M |
| 3300012205|Ga0137362_10335175 | Not Available | 1310 | Open in IMG/M |
| 3300012207|Ga0137381_11030901 | Not Available | 709 | Open in IMG/M |
| 3300012209|Ga0137379_11217850 | Not Available | 660 | Open in IMG/M |
| 3300012210|Ga0137378_10126045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2365 | Open in IMG/M |
| 3300012210|Ga0137378_10474540 | Not Available | 1157 | Open in IMG/M |
| 3300012361|Ga0137360_11480531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300012951|Ga0164300_10921635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300012971|Ga0126369_11272715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300012971|Ga0126369_11750626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300012971|Ga0126369_11760215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300012984|Ga0164309_11413181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300014054|Ga0120135_1092039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300014200|Ga0181526_10202475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB20 | 1270 | Open in IMG/M |
| 3300014638|Ga0181536_10117992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1462 | Open in IMG/M |
| 3300016319|Ga0182033_10230240 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300016341|Ga0182035_11320366 | Not Available | 646 | Open in IMG/M |
| 3300016371|Ga0182034_11356707 | Not Available | 621 | Open in IMG/M |
| 3300016371|Ga0182034_12072120 | Not Available | 502 | Open in IMG/M |
| 3300016387|Ga0182040_10244895 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300016404|Ga0182037_10988594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300016445|Ga0182038_11242306 | Not Available | 665 | Open in IMG/M |
| 3300017940|Ga0187853_10402310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300017961|Ga0187778_11238415 | Not Available | 524 | Open in IMG/M |
| 3300017994|Ga0187822_10327823 | Not Available | 547 | Open in IMG/M |
| 3300018008|Ga0187888_1022433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3283 | Open in IMG/M |
| 3300021168|Ga0210406_10279474 | Not Available | 1363 | Open in IMG/M |
| 3300021181|Ga0210388_10805264 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300021407|Ga0210383_10364646 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300021479|Ga0210410_11377389 | Not Available | 598 | Open in IMG/M |
| 3300021560|Ga0126371_13892830 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025439|Ga0208323_1021676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
| 3300025457|Ga0208850_1038427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300025457|Ga0208850_1054311 | Not Available | 662 | Open in IMG/M |
| 3300025891|Ga0209585_10475727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300026498|Ga0257156_1136439 | Not Available | 511 | Open in IMG/M |
| 3300027908|Ga0209006_10772240 | Not Available | 781 | Open in IMG/M |
| 3300027910|Ga0209583_10407163 | Not Available | 649 | Open in IMG/M |
| 3300028047|Ga0209526_10617517 | Not Available | 692 | Open in IMG/M |
| 3300028819|Ga0307296_10370356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300031226|Ga0307497_10732593 | Not Available | 513 | Open in IMG/M |
| 3300031546|Ga0318538_10459725 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031546|Ga0318538_10525526 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031561|Ga0318528_10754193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300031572|Ga0318515_10046780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2165 | Open in IMG/M |
| 3300031573|Ga0310915_10941560 | Not Available | 604 | Open in IMG/M |
| 3300031573|Ga0310915_10969238 | Not Available | 594 | Open in IMG/M |
| 3300031679|Ga0318561_10018285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3213 | Open in IMG/M |
| 3300031680|Ga0318574_10358795 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031708|Ga0310686_112642128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300031708|Ga0310686_119089095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2695 | Open in IMG/M |
| 3300031719|Ga0306917_11016242 | Not Available | 647 | Open in IMG/M |
| 3300031724|Ga0318500_10254621 | Not Available | 852 | Open in IMG/M |
| 3300031744|Ga0306918_11238511 | Not Available | 575 | Open in IMG/M |
| 3300031747|Ga0318502_10885372 | Not Available | 542 | Open in IMG/M |
| 3300031754|Ga0307475_10685582 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031763|Ga0318537_10322601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031768|Ga0318509_10775548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300031770|Ga0318521_10173517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300031770|Ga0318521_10198809 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300031798|Ga0318523_10577010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031835|Ga0318517_10012033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 3125 | Open in IMG/M |
| 3300031845|Ga0318511_10416170 | Not Available | 617 | Open in IMG/M |
| 3300031879|Ga0306919_10358718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1114 | Open in IMG/M |
| 3300031893|Ga0318536_10434888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031942|Ga0310916_10013397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5565 | Open in IMG/M |
| 3300031942|Ga0310916_11533620 | Not Available | 542 | Open in IMG/M |
| 3300031942|Ga0310916_11573203 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031946|Ga0310910_10649188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300031954|Ga0306926_11063270 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300031954|Ga0306926_11786508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031954|Ga0306926_12526133 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031962|Ga0307479_10350159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1460 | Open in IMG/M |
| 3300032001|Ga0306922_11573292 | Not Available | 655 | Open in IMG/M |
| 3300032010|Ga0318569_10579554 | Not Available | 522 | Open in IMG/M |
| 3300032042|Ga0318545_10082012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300032042|Ga0318545_10307137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300032059|Ga0318533_11247569 | Not Available | 543 | Open in IMG/M |
| 3300032064|Ga0318510_10379417 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032090|Ga0318518_10456973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300032261|Ga0306920_101849650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. BH-1 | 850 | Open in IMG/M |
| 3300032261|Ga0306920_103347622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032261|Ga0306920_103845742 | Not Available | 548 | Open in IMG/M |
| 3300033289|Ga0310914_11291579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 632 | Open in IMG/M |
| 3300033887|Ga0334790_145143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066794_102583802 | 3300005947 | Soil | MELNRPPLVVAFELSEKRKAIVADALAGASAVVYLTE |
| Ga0066798_101276471 | 3300005980 | Soil | MELNRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAAR |
| Ga0075021_105235152 | 3300006354 | Watersheds | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDE |
| Ga0075425_1019911661 | 3300006854 | Populus Rhizosphere | MEFSRPPLVVAFELSEKRKAIAADALAGASDVVYLTELD |
| Ga0099829_103324894 | 3300009038 | Vadose Zone Soil | MELSRPPLVVAFELSEKRKAIVADALAGASTVVYLTEL |
| Ga0099828_119483532 | 3300009089 | Vadose Zone Soil | LHWTDAPLVIAFALSEKRKAIVAAALAGASAVVYLTE |
| Ga0116218_12579571 | 3300009522 | Peatlands Soil | MELSRPPLVVAFELSEKRKAIVANALAGASAVAYLTELDDAARTRFRVN* |
| Ga0116102_11866161 | 3300009632 | Peatland | MDLSPLPLVVAFELSEKRKAIVADALAGASAVVYLTELD |
| Ga0116216_104368872 | 3300009698 | Peatlands Soil | MELSRPPLVVAFELNEKRKAIVADALAGASAVVYLVAAELHR* |
| Ga0116131_10799553 | 3300009760 | Peatland | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARAE |
| Ga0126374_106376041 | 3300009792 | Tropical Forest Soil | MEFSRPPLVIAFELSEPRKAIVADTLAGVSDVVYLTELDEAART |
| Ga0126382_112903711 | 3300010047 | Tropical Forest Soil | MELSRPPLVVAFELSERRKAIVADALAGASAVIYLTELDGAARAEALR |
| Ga0126373_129538151 | 3300010048 | Tropical Forest Soil | MEFSRPPLVVAFELSETRKAIVAETLAGVSAVVYLTELD |
| Ga0126370_115491641 | 3300010358 | Tropical Forest Soil | ANLGGAMELNRPPLVITFELSDRRKAIVTDALAGASAVVYLTELDEAAR* |
| Ga0126372_103478133 | 3300010360 | Tropical Forest Soil | MEFSRPPLVIAFELSETRKAIVADTLAGASDVVYLTELDEAARAEALR |
| Ga0126372_110429672 | 3300010360 | Tropical Forest Soil | MEFSRPPLVVAFELSKKRKAIVADALAGASDVVCLTELDEAARA |
| Ga0126378_113281173 | 3300010361 | Tropical Forest Soil | MELSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDE |
| Ga0126379_126491961 | 3300010366 | Tropical Forest Soil | MEFSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDEAAR |
| Ga0126379_128687561 | 3300010366 | Tropical Forest Soil | MEFSRPPLVVAFELSEKRKAIVADALAGASDVVYLTEI |
| Ga0126381_1031750491 | 3300010376 | Tropical Forest Soil | MDLSRPPLVVGFELSEKRKAIVADALAGASDVVYLT |
| Ga0136449_1025107461 | 3300010379 | Peatlands Soil | MELSRPPLVVAFELGEKRKAIVADALAGVSAVVYLTELDEAARAE |
| Ga0136449_1029957932 | 3300010379 | Peatlands Soil | MELSRSPLVVTFELSEKRKAIVADTLAGASAVVYLTELDEA* |
| Ga0126383_132845242 | 3300010398 | Tropical Forest Soil | MEFSRPPLVVAFELSEKRKAIVADALAGASDVVCLTELDEASRAEALR |
| Ga0137363_100901384 | 3300012202 | Vadose Zone Soil | MEFSRPPLVVAFELSEKRKAIVADTLAGVSAVVYLTELDE |
| Ga0137362_103351752 | 3300012205 | Vadose Zone Soil | MEFNRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDSVPSHA* |
| Ga0137381_110309012 | 3300012207 | Vadose Zone Soil | MELSRPPLVVAFELSEKRKAIVADAPVGASAVVYLTELDEAAHETDN* |
| Ga0137379_112178501 | 3300012209 | Vadose Zone Soil | MQLTRLPLVVAFELSEKRRTILTDALAGAAPVVYLTELDAAGRAEA |
| Ga0137378_101260451 | 3300012210 | Vadose Zone Soil | MELNRLPLVVTFELSEQRKAIVNDALAGATDVVYLTE |
| Ga0137378_104745401 | 3300012210 | Vadose Zone Soil | MEFSPPPLVIAFELSETRKAIVADTLAGASDVVYLTELDEAAR |
| Ga0137360_114805312 | 3300012361 | Vadose Zone Soil | MEFSPPPLVIAFELSETRKAIVADTLAGASDVVYLPELDEAARAEAL |
| Ga0164300_109216352 | 3300012951 | Soil | MELSRPPLVVAFELSERRKAIVADALAGASVVIYLTELDGTA |
| Ga0126369_112727151 | 3300012971 | Tropical Forest Soil | MELSRPPLVVAFEMSQKHKAIVADNLAGASDVVYL |
| Ga0126369_117506262 | 3300012971 | Tropical Forest Soil | MEFSRPPLVVAFELSEKRKAIVADTLAGASDVVYL |
| Ga0126369_117602151 | 3300012971 | Tropical Forest Soil | MEFSRPPLVIAFELSEKRKAIVADALAGASDVVYLTELD |
| Ga0164309_114131812 | 3300012984 | Soil | MELSRLPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAAR |
| Ga0120135_10920392 | 3300014054 | Permafrost | MELVRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARAEALCN |
| Ga0181526_102024752 | 3300014200 | Bog | MKLSRSPLVVAFELSEKRKAIVADALAGAGAVVYLTELDEAARAEALR |
| Ga0181536_101179921 | 3300014638 | Bog | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDESDRAE |
| Ga0182033_102302403 | 3300016319 | Soil | DLSRPPLVIGFELSEKRKAIVADALAGAGAVVYLGTG |
| Ga0182035_113203661 | 3300016341 | Soil | MRLNRPLLVVAFELSERRKVIVADALAGAARVVYLTE |
| Ga0182034_113567072 | 3300016371 | Soil | MALNRPPLVVAFELSEKRKAIVADALAGASAILYLTEVDEAARAE |
| Ga0182034_120721201 | 3300016371 | Soil | MELSQPPLVVAFEVSEKRKAIVAEALAGTSAVVYLTE |
| Ga0182040_102448952 | 3300016387 | Soil | MELSRPLVIAFALSQRRKAIVADALAGASAVVYLTELDETARA |
| Ga0182037_109885943 | 3300016404 | Soil | MELSRPLVVAFALSQKRKAIVADALAGASAVVYLTELDET |
| Ga0182038_112423061 | 3300016445 | Soil | MELSQPPLVVAFEVSEKRKAIVAEALAGTSAVVYLTELDHTARAEA |
| Ga0187853_104023101 | 3300017940 | Peatland | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELD |
| Ga0187778_112384151 | 3300017961 | Tropical Peatland | MELNRPPLVVAFGLSEKRKAIVADALAGASAVVYLTELDQADRAEVLR |
| Ga0187822_103278231 | 3300017994 | Freshwater Sediment | MELSQPALVVAFALSQKRRAIAADALAGASAVVHLTELDETARTE |
| Ga0187888_10224335 | 3300018008 | Peatland | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARAEALR |
| Ga0210406_102794741 | 3300021168 | Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYL |
| Ga0210388_108052643 | 3300021181 | Soil | MELSGPLVVAFALSQKRKAIVADALAGASAVVYLTELGETARTEALR |
| Ga0210383_103646461 | 3300021407 | Soil | MGLSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARA |
| Ga0210410_113773892 | 3300021479 | Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTEL |
| Ga0126371_138928302 | 3300021560 | Tropical Forest Soil | LNPPPLVVAFELSQRRKSIVADALAGASAIIYLAELDRAAR |
| Ga0208323_10216761 | 3300025439 | Peatland | MELSRPPLIVAFELSEKHKAIVAHALAGASAVVYLTELDEA |
| Ga0208850_10384271 | 3300025457 | Arctic Peat Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLT |
| Ga0208850_10543111 | 3300025457 | Arctic Peat Soil | MELNRPPLVVAFELSEKRKAIVADALAGASAVVYLT |
| Ga0209585_104757271 | 3300025891 | Arctic Peat Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLIEL |
| Ga0257156_11364391 | 3300026498 | Soil | LGCMEFSRPPLVVAFELSEKRKAIVADTLAGVSAVVY |
| Ga0209006_107722402 | 3300027908 | Forest Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEA |
| Ga0209583_104071631 | 3300027910 | Watersheds | MELSRPPLVVAFELSDRHKAIVADALSGASTVVYLTELDEAA |
| Ga0209526_106175172 | 3300028047 | Forest Soil | LSRPPLVVAFELSERRKAIVAGALAGASVVIYLTELDGTARAEAL |
| Ga0307296_103703563 | 3300028819 | Soil | MELSRPQLVVAFELSEKRNNKAIVADALAGASAVV |
| Ga0307497_107325932 | 3300031226 | Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARTEAL |
| Ga0318538_104597251 | 3300031546 | Soil | MEFSRPPLVIAFELSEKRKAIVADALAGASNVVYL |
| Ga0318538_105255262 | 3300031546 | Soil | MELSRPPLVVAFELSQKRKAIVADALAGASDVVYL |
| Ga0318528_107541931 | 3300031561 | Soil | LSRPPLVVAFGLSEKRKAIVADALAGASDVVCLTELD |
| Ga0318515_100467801 | 3300031572 | Soil | MEFSRPPLVVAFELSEPRKAIVADTLAGVSDVVYLTDLDEA |
| Ga0310915_109415602 | 3300031573 | Soil | MGLNRPLLVVAFELSERRKVIVADALAGAARVVYLTELDEMARAEAL |
| Ga0310915_109692381 | 3300031573 | Soil | LNRPLLVVAFELSERRKVIVADALAGAARVVYLTELDE |
| Ga0318561_100182854 | 3300031679 | Soil | MEFSRPPLVVAFGLSEKRKAIVADALAGASDVVCLTEL |
| Ga0318574_103587951 | 3300031680 | Soil | MDLSRPPLVIGFELSEKRKAIVADALAGAGAVVYLGTG |
| Ga0310686_1126421285 | 3300031708 | Soil | MELSRPPLVVAFKLSEKRKAIVADALAGASAVVYLT |
| Ga0310686_1190890951 | 3300031708 | Soil | MELSRPPLVVTFELSEKRKAIVADALAGASAVVYLTELN |
| Ga0306917_110162421 | 3300031719 | Soil | MRLNRPLLVVAFELSERRKVIVADALAGAARVVYLTELDETARAE |
| Ga0318500_102546211 | 3300031724 | Soil | MELSRPLVIAFALSQRRKAIVADALAGASAVVYLTE |
| Ga0306918_112385111 | 3300031744 | Soil | MALKRPPLVVTFALSEKRKAIVADALAGASPVLYLTELDEA |
| Ga0318502_108853722 | 3300031747 | Soil | MEFSRPPLVIAFELSEKRKAIVADALAGASNVVYLTELDKAARAE |
| Ga0307475_106855821 | 3300031754 | Hardwood Forest Soil | MELSGPLVVAFALSQKRKAIVADALAGASAVVYLTELDET |
| Ga0318537_103226011 | 3300031763 | Soil | LSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDEAARAE |
| Ga0318509_107755481 | 3300031768 | Soil | MELSPPPLVVAFELSERRKSIVADGLAGASPIVCLAELDGTARVEALRS |
| Ga0318521_101735172 | 3300031770 | Soil | MEFSRPPLVIAFELSEKRKAIVADTLAGASDVVYLTDLDEA |
| Ga0318521_101988091 | 3300031770 | Soil | MDLSRPPLVVTFELSERRKVIVANALSGASTVVYLTKLD |
| Ga0318523_105770101 | 3300031798 | Soil | LGCMEFTRPPLVVAFELSEKRKAIVADALAGVSAVIYLTEID |
| Ga0318517_100120333 | 3300031835 | Soil | MEFSRPPLVVAFELSEPRKAIVADTLAGVSDVAYLTELDE |
| Ga0318511_104161701 | 3300031845 | Soil | LSRPSLVVAFELSERSKAIVADALAGASAVVYLTELRGTVRA |
| Ga0306919_103587182 | 3300031879 | Soil | MNLSRSPLVVTFKLSERRKAIVADVLAGASAVVYLTELDGAARAEVGRHT |
| Ga0318536_104348881 | 3300031893 | Soil | LGCMEFTRPPLVVAFELSEKRKAIVADALAGVSAVIYLTEIDDVARAE |
| Ga0310916_100133976 | 3300031942 | Soil | MLGYMEFSRPPLVVAFELSEKRKALVADTLAGASDVVLPHRPR |
| Ga0310916_115336202 | 3300031942 | Soil | MELSRPPLVVAFELSEKRKAIVADALAGTSAVVYLTELDEAAP |
| Ga0310916_115732032 | 3300031942 | Soil | MELSRPLVVAFALSQKHKAIVADALAGASAVVYLTELDETARTE |
| Ga0310910_106491882 | 3300031946 | Soil | MGLSRPSLVVAFELSERSKAIVADALAGASAVIYLTELRGTVRAE |
| Ga0306926_110632702 | 3300031954 | Soil | LSRPPLVVAFELSQKRKAIVADALAGASDVVYLTELDE |
| Ga0306926_117865083 | 3300031954 | Soil | MEFSRPPLVIAFELSETRKAIVADALAGVSAVVYLTELD |
| Ga0306926_125261332 | 3300031954 | Soil | MPAGPPLVVAFQLSEKRKPIVTAGLAGAAPVIYLTELDAAERAAA |
| Ga0307479_103501591 | 3300031962 | Hardwood Forest Soil | MELSRPPLVVAFALSPKRKAIVTDALAGASAVVYLTELDEMARTEALR |
| Ga0306922_115732921 | 3300032001 | Soil | MGLNRPLLVVAFELSERRKAIVADALAGAARVVYLTELD |
| Ga0318569_105795541 | 3300032010 | Soil | MEFSRPPLVIAFELSEPRKAIVADILAGVSDVVYL |
| Ga0318545_100820122 | 3300032042 | Soil | MDLSRPPLVIGFELSEKRKAIVADALAGAGAVVYLG |
| Ga0318545_103071371 | 3300032042 | Soil | LSRPPLVVAFELSEKRKAIVADALAGASDVVYLTDL |
| Ga0318533_112475692 | 3300032059 | Soil | MELSRPPLVIAFELSETRKAIVADTLAGASDVVYLTELD |
| Ga0318510_103794172 | 3300032064 | Soil | MEFSRPPLVIAFELSEPRKAIVADILAGVSDVVYLTE |
| Ga0318518_104569731 | 3300032090 | Soil | MDLSRPPLVVGFELSEKRKAIVADALAGASAVVYL |
| Ga0306920_1018496501 | 3300032261 | Soil | MNLSRSPLVVTFKLSERRKAIVADVLAGASAVAYLTELDEAAEVLR |
| Ga0306920_1033476223 | 3300032261 | Soil | LSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDE |
| Ga0306920_1038457422 | 3300032261 | Soil | MEFSRPTLVIAFELSKKRKAIVADALVGASDVVYLTELD |
| Ga0310914_112915791 | 3300033289 | Soil | VVILGCMELSRPPLVVAFELSEKRKAIVADALAGA |
| Ga0334790_145143_592_717 | 3300033887 | Soil | MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAA |
| ⦗Top⦘ |