


| Basic Information | |
|---|---|
| Family ID | F090465 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSSKITNQLVLDCIKQMREKTKERKFKQTVELQVALKDYDP |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.52 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (98.148 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.185 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.593 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00687 | Ribosomal_L1 | 83.33 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0081 | Ribosomal protein L1 | Translation, ribosomal structure and biogenesis [J] | 83.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.07 % |
| Unclassified | root | N/A | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_101093921 | All Organisms → cellular organisms → Eukaryota | 674 | Open in IMG/M |
| 3300004764|Ga0007754_1402923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300004769|Ga0007748_10111544 | All Organisms → cellular organisms → Eukaryota | 881 | Open in IMG/M |
| 3300004789|Ga0007752_10040956 | All Organisms → cellular organisms → Eukaryota | 747 | Open in IMG/M |
| 3300004790|Ga0007758_10033401 | All Organisms → cellular organisms → Eukaryota | 820 | Open in IMG/M |
| 3300006356|Ga0075487_1442235 | All Organisms → cellular organisms → Eukaryota | 793 | Open in IMG/M |
| 3300006379|Ga0075513_1304567 | All Organisms → cellular organisms → Eukaryota | 593 | Open in IMG/M |
| 3300006397|Ga0075488_1625571 | All Organisms → cellular organisms → Eukaryota | 845 | Open in IMG/M |
| 3300006415|Ga0099654_10551731 | All Organisms → cellular organisms → Eukaryota | 815 | Open in IMG/M |
| 3300008108|Ga0114341_10243066 | All Organisms → cellular organisms → Eukaryota | 975 | Open in IMG/M |
| 3300008993|Ga0104258_1042053 | All Organisms → cellular organisms → Eukaryota | 856 | Open in IMG/M |
| 3300009441|Ga0115007_10263510 | All Organisms → cellular organisms → Eukaryota | 1116 | Open in IMG/M |
| 3300009543|Ga0115099_10126042 | All Organisms → cellular organisms → Eukaryota | 518 | Open in IMG/M |
| 3300009599|Ga0115103_1169288 | All Organisms → cellular organisms → Eukaryota | 827 | Open in IMG/M |
| 3300009608|Ga0115100_10939481 | All Organisms → cellular organisms → Eukaryota | 821 | Open in IMG/M |
| 3300009677|Ga0115104_11015294 | All Organisms → cellular organisms → Eukaryota | 637 | Open in IMG/M |
| 3300010306|Ga0129322_1081858 | All Organisms → cellular organisms → Eukaryota | 904 | Open in IMG/M |
| 3300010404|Ga0129323_1086899 | All Organisms → cellular organisms → Eukaryota | 721 | Open in IMG/M |
| 3300010981|Ga0138316_11273863 | All Organisms → cellular organisms → Eukaryota | 647 | Open in IMG/M |
| 3300010981|Ga0138316_11295364 | All Organisms → cellular organisms → Eukaryota | 648 | Open in IMG/M |
| 3300010985|Ga0138326_11367807 | All Organisms → cellular organisms → Eukaryota | 557 | Open in IMG/M |
| 3300012518|Ga0129349_1344797 | All Organisms → cellular organisms → Eukaryota | 801 | Open in IMG/M |
| 3300012713|Ga0157544_1097097 | All Organisms → cellular organisms → Eukaryota | 528 | Open in IMG/M |
| 3300012715|Ga0157599_1082325 | All Organisms → cellular organisms → Eukaryota | 780 | Open in IMG/M |
| 3300012756|Ga0138272_1100290 | All Organisms → cellular organisms → Eukaryota | 720 | Open in IMG/M |
| 3300012771|Ga0138270_1053962 | All Organisms → cellular organisms → Eukaryota | 700 | Open in IMG/M |
| 3300012778|Ga0138269_1296606 | All Organisms → cellular organisms → Eukaryota | 755 | Open in IMG/M |
| 3300012968|Ga0129337_1221896 | All Organisms → cellular organisms → Eukaryota | 755 | Open in IMG/M |
| 3300012969|Ga0129332_1067852 | All Organisms → cellular organisms → Eukaryota | 914 | Open in IMG/M |
| 3300012970|Ga0129338_1311469 | All Organisms → cellular organisms → Eukaryota | 759 | Open in IMG/M |
| 3300013295|Ga0170791_13127293 | All Organisms → cellular organisms → Eukaryota | 646 | Open in IMG/M |
| 3300013295|Ga0170791_16302568 | All Organisms → cellular organisms → Eukaryota | 749 | Open in IMG/M |
| 3300018622|Ga0188862_1011358 | All Organisms → cellular organisms → Eukaryota | 798 | Open in IMG/M |
| 3300018739|Ga0192974_1032662 | All Organisms → cellular organisms → Eukaryota | 902 | Open in IMG/M |
| 3300018871|Ga0192978_1037180 | All Organisms → cellular organisms → Eukaryota | 915 | Open in IMG/M |
| 3300018871|Ga0192978_1046054 | All Organisms → cellular organisms → Eukaryota | 819 | Open in IMG/M |
| 3300018989|Ga0193030_10125243 | All Organisms → cellular organisms → Eukaryota | 815 | Open in IMG/M |
| 3300019017|Ga0193569_10171205 | All Organisms → cellular organisms → Eukaryota | 976 | Open in IMG/M |
| 3300019031|Ga0193516_10102241 | All Organisms → cellular organisms → Eukaryota | 976 | Open in IMG/M |
| 3300019031|Ga0193516_10171015 | All Organisms → cellular organisms → Eukaryota | 729 | Open in IMG/M |
| 3300019048|Ga0192981_10162564 | All Organisms → cellular organisms → Eukaryota | 881 | Open in IMG/M |
| 3300019108|Ga0192972_1043156 | All Organisms → cellular organisms → Eukaryota | 881 | Open in IMG/M |
| 3300019149|Ga0188870_10078422 | All Organisms → cellular organisms → Eukaryota | 804 | Open in IMG/M |
| 3300019149|Ga0188870_10093275 | All Organisms → cellular organisms → Eukaryota | 727 | Open in IMG/M |
| 3300021169|Ga0206687_1400533 | All Organisms → cellular organisms → Eukaryota | 815 | Open in IMG/M |
| 3300021345|Ga0206688_10038940 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300021345|Ga0206688_10101396 | All Organisms → cellular organisms → Eukaryota | 644 | Open in IMG/M |
| 3300021350|Ga0206692_1327536 | All Organisms → cellular organisms → Eukaryota | 705 | Open in IMG/M |
| 3300021350|Ga0206692_1707071 | All Organisms → cellular organisms → Eukaryota | 524 | Open in IMG/M |
| 3300021353|Ga0206693_1618103 | All Organisms → cellular organisms → Eukaryota | 625 | Open in IMG/M |
| 3300021359|Ga0206689_10367704 | All Organisms → cellular organisms → Eukaryota | 823 | Open in IMG/M |
| 3300021424|Ga0194117_10493108 | All Organisms → cellular organisms → Eukaryota | 548 | Open in IMG/M |
| 3300021869|Ga0063107_100083 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
| 3300021872|Ga0063132_105335 | All Organisms → cellular organisms → Eukaryota | 799 | Open in IMG/M |
| 3300021879|Ga0063113_118685 | All Organisms → cellular organisms → Eukaryota | 834 | Open in IMG/M |
| 3300021885|Ga0063125_1007358 | All Organisms → cellular organisms → Eukaryota | 700 | Open in IMG/M |
| 3300021885|Ga0063125_1015041 | All Organisms → cellular organisms → Eukaryota | 865 | Open in IMG/M |
| 3300021887|Ga0063105_1001369 | All Organisms → cellular organisms → Eukaryota | 772 | Open in IMG/M |
| 3300021889|Ga0063089_1022062 | All Organisms → cellular organisms → Eukaryota | 758 | Open in IMG/M |
| 3300021899|Ga0063144_1152801 | All Organisms → cellular organisms → Eukaryota | 549 | Open in IMG/M |
| 3300021902|Ga0063086_1017899 | All Organisms → cellular organisms → Eukaryota | 566 | Open in IMG/M |
| 3300021906|Ga0063087_1045664 | All Organisms → cellular organisms → Eukaryota | 700 | Open in IMG/M |
| 3300021910|Ga0063100_1001260 | All Organisms → cellular organisms → Eukaryota | 660 | Open in IMG/M |
| 3300021913|Ga0063104_1001103 | All Organisms → cellular organisms → Eukaryota | 804 | Open in IMG/M |
| 3300021922|Ga0063869_1034759 | All Organisms → cellular organisms → Eukaryota | 719 | Open in IMG/M |
| 3300021927|Ga0063103_1004425 | All Organisms → cellular organisms → Eukaryota | 709 | Open in IMG/M |
| 3300021927|Ga0063103_1096690 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
| 3300021928|Ga0063134_1176801 | All Organisms → cellular organisms → Eukaryota | 589 | Open in IMG/M |
| 3300021941|Ga0063102_1014584 | All Organisms → cellular organisms → Eukaryota | 708 | Open in IMG/M |
| 3300021943|Ga0063094_1000873 | All Organisms → cellular organisms → Eukaryota | 810 | Open in IMG/M |
| 3300021954|Ga0063755_1082222 | All Organisms → cellular organisms → Eukaryota | 769 | Open in IMG/M |
| 3300023567|Ga0228694_115399 | All Organisms → cellular organisms → Eukaryota | 803 | Open in IMG/M |
| 3300023683|Ga0228681_1016475 | All Organisms → cellular organisms → Eukaryota | 842 | Open in IMG/M |
| 3300023704|Ga0228684_1055951 | All Organisms → cellular organisms → Eukaryota | 614 | Open in IMG/M |
| 3300026434|Ga0247591_1071723 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
| 3300026448|Ga0247594_1041007 | All Organisms → cellular organisms → Eukaryota | 790 | Open in IMG/M |
| 3300026461|Ga0247600_1033568 | All Organisms → cellular organisms → Eukaryota | 989 | Open in IMG/M |
| 3300026465|Ga0247588_1100430 | All Organisms → cellular organisms → Eukaryota | 579 | Open in IMG/M |
| 3300026468|Ga0247603_1034594 | All Organisms → cellular organisms → Eukaryota | 993 | Open in IMG/M |
| 3300026470|Ga0247599_1123566 | All Organisms → cellular organisms → Eukaryota | 539 | Open in IMG/M |
| 3300026495|Ga0247571_1066854 | All Organisms → cellular organisms → Eukaryota | 822 | Open in IMG/M |
| 3300026495|Ga0247571_1158534 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
| 3300026500|Ga0247592_1075299 | All Organisms → cellular organisms → Eukaryota | 820 | Open in IMG/M |
| 3300026503|Ga0247605_1078904 | All Organisms → cellular organisms → Eukaryota | 811 | Open in IMG/M |
| 3300027712|Ga0209499_1144308 | Not Available | 873 | Open in IMG/M |
| 3300028109|Ga0247582_1086526 | All Organisms → cellular organisms → Eukaryota | 819 | Open in IMG/M |
| 3300028282|Ga0256413_1172777 | All Organisms → cellular organisms → Eukaryota | 780 | Open in IMG/M |
| 3300028575|Ga0304731_11671971 | All Organisms → cellular organisms → Eukaryota | 647 | Open in IMG/M |
| 3300030670|Ga0307401_10174373 | All Organisms → cellular organisms → Eukaryota | 965 | Open in IMG/M |
| 3300030670|Ga0307401_10182344 | All Organisms → cellular organisms → Eukaryota | 944 | Open in IMG/M |
| 3300030670|Ga0307401_10251624 | All Organisms → cellular organisms → Eukaryota | 801 | Open in IMG/M |
| 3300030699|Ga0307398_10276751 | All Organisms → cellular organisms → Eukaryota | 907 | Open in IMG/M |
| 3300030702|Ga0307399_10258183 | All Organisms → cellular organisms → Eukaryota | 821 | Open in IMG/M |
| 3300031522|Ga0307388_10688398 | All Organisms → cellular organisms → Eukaryota | 682 | Open in IMG/M |
| 3300031710|Ga0307386_10502889 | All Organisms → cellular organisms → Eukaryota | 634 | Open in IMG/M |
| 3300031725|Ga0307381_10116317 | All Organisms → cellular organisms → Eukaryota | 892 | Open in IMG/M |
| 3300031734|Ga0307397_10179068 | All Organisms → cellular organisms → Eukaryota | 929 | Open in IMG/M |
| 3300031739|Ga0307383_10183811 | All Organisms → cellular organisms → Eukaryota | 979 | Open in IMG/M |
| 3300031739|Ga0307383_10281112 | All Organisms → cellular organisms → Eukaryota | 802 | Open in IMG/M |
| 3300031739|Ga0307383_10415188 | All Organisms → cellular organisms → Eukaryota | 663 | Open in IMG/M |
| 3300031742|Ga0307395_10170088 | All Organisms → cellular organisms → Eukaryota | 918 | Open in IMG/M |
| 3300031742|Ga0307395_10371856 | All Organisms → cellular organisms → Eukaryota | 620 | Open in IMG/M |
| 3300032150|Ga0314779_1012472 | All Organisms → cellular organisms → Eukaryota | 794 | Open in IMG/M |
| 3300032518|Ga0314689_10469838 | All Organisms → cellular organisms → Eukaryota | 659 | Open in IMG/M |
| 3300032521|Ga0314680_10343240 | All Organisms → cellular organisms → Eukaryota | 917 | Open in IMG/M |
| 3300032651|Ga0314685_10499461 | All Organisms → cellular organisms → Eukaryota | 669 | Open in IMG/M |
| 3300032714|Ga0314686_10365838 | All Organisms → cellular organisms → Eukaryota | 718 | Open in IMG/M |
| 3300032746|Ga0314701_10328245 | All Organisms → cellular organisms → Eukaryota | 694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.19% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 13.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.04% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.48% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 6.48% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 4.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.93% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004764 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006356 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006379 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006415 | Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010306 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010404 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
| 3300010985 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8) | Environmental | Open in IMG/M |
| 3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012713 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012756 | Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012771 | Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300018622 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dT | Environmental | Open in IMG/M |
| 3300018739 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246) | Environmental | Open in IMG/M |
| 3300018871 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345) | Environmental | Open in IMG/M |
| 3300018989 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934) | Environmental | Open in IMG/M |
| 3300019017 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781 | Environmental | Open in IMG/M |
| 3300019031 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019108 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135) | Environmental | Open in IMG/M |
| 3300019149 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021869 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021872 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021879 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021885 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021887 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021889 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021899 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021902 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021906 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021910 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021913 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021922 | Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021927 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021928 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021941 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021943 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021954 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023683 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026434 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026448 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026461 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026465 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026468 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030670 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030699 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030702 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031522 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031710 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031734 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031742 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032150 | Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032518 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032521 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032651 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032714 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032746 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1010939211 | 3300002835 | Freshwater | MTSKITNQLVLDSIKQMREKTKERKFKQTVELQVALKDYDP* |
| Ga0007754_14029233 | 3300004764 | Freshwater Lake | HLIMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0007748_101115444 | 3300004769 | Freshwater Lake | THLIMASKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0007752_100409561 | 3300004789 | Freshwater Lake | MASKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0007758_100334011 | 3300004790 | Freshwater Lake | SKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0075487_14422351 | 3300006356 | Aqueous | MSSKITNAQTLECIKQMKDNTKERKFKQTVELQVGIKDYDP* |
| Ga0075513_13045672 | 3300006379 | Aqueous | TNAQTLECIKQMKDNTKERKFKQTVELQVGIKDYDP* |
| Ga0075488_16255711 | 3300006397 | Aqueous | KVMSSKITNAQTLECIKQMKDNTKERKFKQTVELQVGIKDYDP* |
| Ga0099654_105517311 | 3300006415 | Lake | KTHLIMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0114341_102430662 | 3300008108 | Freshwater, Plankton | MSSKITNQLVLDCIKQMRENTKERKFKQTVELQVALKDYDP* |
| Ga0104258_10420531 | 3300008993 | Ocean Water | KITNALVLECIKEMKKGSKDRKFTQTVELQVGLKDYDP* |
| Ga0115007_102635101 | 3300009441 | Marine | MSSKITNALVLECITTMREGAKKRKFTQTVELQVGIKDYDP* |
| Ga0115099_101260422 | 3300009543 | Marine | SKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP* |
| Ga0115103_11692881 | 3300009599 | Marine | RAMTSKITNAHTLECIAKMREGTKARKFTQTAELQVAIKDYDP* |
| Ga0115100_109394812 | 3300009608 | Marine | LRAMTSKITNAHTLECIAKMREGTKARKFTQTAELQVAIKDYDP* |
| Ga0115104_110152942 | 3300009677 | Marine | AGVLDNIATLRETHKARKFKQTVELQVGIKDYDP* |
| Ga0129322_10818582 | 3300010306 | Aqueous | FRMSKITNALVLSCIKEMREKSKERKFMQTVELQVALKDYDP* |
| Ga0129323_10868992 | 3300010404 | Aqueous | KITNALVLSCIKEMREKSKERKFMQTVELQVALKDYDP* |
| Ga0138316_112738633 | 3300010981 | Marine | SKITNALVLECIDDMRKKTKERKFAQTVELQVALKDYDP* |
| Ga0138316_112953641 | 3300010981 | Marine | ALVLECIKKMREGTKKRGFTQTVELQVALKDYDP* |
| Ga0138326_113678071 | 3300010985 | Marine | TNALVLECIDDMRKKTKERKFAQTVELQVALKDYDP* |
| Ga0129349_13447972 | 3300012518 | Aqueous | SKITNALVLDSIKEMREKSKKERKFQETVELQIALKDYDP* |
| Ga0157544_10970972 | 3300012713 | Freshwater | TNQLVLDSIKQMREKTKERKFKQTVELQVALKDYDP* |
| Ga0157599_10823252 | 3300012715 | Freshwater | KITNQLVLDCIKQMRENTKERKFKQTVELQVALKDYDP* |
| Ga0138272_11002901 | 3300012756 | Freshwater Lake | HKVMSSKINNALVLNCIKEMRENSKARKFKQTVELQVSLKDYDP* |
| Ga0138270_10539622 | 3300012771 | Freshwater Lake | KINNALVLNCIKEMRENSKARKFKQTVELQVSLKDYDP* |
| Ga0138269_12966061 | 3300012778 | Freshwater Lake | LIMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0129337_12218961 | 3300012968 | Aqueous | MQSKISNALVLQCIKEMREKSKKRKFTQTVELQIALKDYDP* |
| Ga0129332_10678522 | 3300012969 | Aqueous | FRMSKITNALVISCIKEMREKSKERKFMQTVELQVALKDYDP* |
| Ga0129338_13114691 | 3300012970 | Aqueous | ITNQLVLDCIKQMREKTKERKFKQTVELQVALKDYDP* |
| Ga0170791_131272931 | 3300013295 | Freshwater | KINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0170791_163025683 | 3300013295 | Freshwater | MASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP* |
| Ga0188862_10113583 | 3300018622 | Freshwater Lake | MSKITNAQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0192974_10326621 | 3300018739 | Marine | MTTQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP |
| Ga0192978_10371801 | 3300018871 | Marine | IQMTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP |
| Ga0192978_10460541 | 3300018871 | Marine | SSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP |
| Ga0193030_101252431 | 3300018989 | Marine | HGIFILNMSSKITNALVLDCIKEMREGAKKRKAGIVQTIELQVALKDYDP |
| Ga0193569_101712051 | 3300019017 | Marine | MTSKITNQLVLDCISEMKGKSKERKFMQTVELQVALKDYDP |
| Ga0193516_101022412 | 3300019031 | Marine | MSSKITAALLKECIEEMRQKTKDRKFKQTVELQVALKDYDP |
| Ga0193516_101710151 | 3300019031 | Marine | HGDLLFDIKLRMTSKISNDLVRECIADMREKTKERKFKQTVELQVALKDYDP |
| Ga0192981_101625641 | 3300019048 | Marine | MGINNLNRMSSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP |
| Ga0192972_10431562 | 3300019108 | Marine | QKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP |
| Ga0188870_100784223 | 3300019149 | Freshwater Lake | KVMSKITNAQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0188870_100932753 | 3300019149 | Freshwater Lake | RMSSKITNAQILDAIKAIKEGKKKRGFTETFELQVGLKDYDP |
| Ga0206687_14005331 | 3300021169 | Seawater | AMSSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP |
| Ga0206688_100389401 | 3300021345 | Seawater | SKITNALVLDCIKRMRDGTKKRGFTQTVELQVALKDYDP |
| Ga0206688_101013961 | 3300021345 | Seawater | MSSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP |
| Ga0206692_13275362 | 3300021350 | Seawater | FFKAMSSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP |
| Ga0206692_17070711 | 3300021350 | Seawater | RMSKITNQLALDCIKTMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0206693_16181031 | 3300021353 | Seawater | KITNALVLECIKKMKEGTKKRNFTQTVELQVALKDYDP |
| Ga0206689_103677043 | 3300021359 | Seawater | SSKITNALVLDCIKRMRDGTKKRGFTQTVELQVALKDYDP |
| Ga0194117_104931082 | 3300021424 | Freshwater Lake | MSSKITNQLVLDCIKQMREKTKERKFKQTVELQVALKDYDP |
| Ga0063107_1000831 | 3300021869 | Marine | MSSKITNALVLECITTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063132_1053351 | 3300021872 | Marine | SKITNALVLECIKQMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063113_1186851 | 3300021879 | Marine | MSSKITNALVLECIKDMRAGTKDRKFAQTVELQVALKDYDP |
| Ga0063125_10073581 | 3300021885 | Marine | SKITNAGVLDCIKNMREKTKARKFKQTVELQVGIKDYDP |
| Ga0063125_10150411 | 3300021885 | Marine | QMSSKITNKIVLEAIENMKEATKKRKFTQTVELQVAIKDYDP |
| Ga0063105_10013691 | 3300021887 | Marine | SSKITNAIVLECIKTMRDGAKKRKFTQTVELQVGIKDYDP |
| Ga0063089_10220621 | 3300021889 | Marine | AMSSKITNALVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063144_11528011 | 3300021899 | Marine | KITAALLKECIEEMRTKTKDRKFKQTVELQVALKDYDP |
| Ga0063086_10178991 | 3300021902 | Marine | SKITNTLVLECVKTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063087_10456641 | 3300021906 | Marine | SKITNALVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063100_10012601 | 3300021910 | Marine | DMSSKITNAIVLECIKTMRDGAKKRKFTQTVELQVGIKDYDP |
| Ga0063104_10011031 | 3300021913 | Marine | KDMSSKITNAIVLECIKTMRDGAKKRKFTQTVELQVGIKDYDP |
| Ga0063869_10347591 | 3300021922 | Marine | KITNALVLESIKDMREGSKVRKFTQTVELQVALKDYDP |
| Ga0063103_10044251 | 3300021927 | Marine | MSSKITNQLVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063103_10966901 | 3300021927 | Marine | SSKISNNLVLECITQMREGTKKRNFTQTVELQVAIKDYDP |
| Ga0063134_11768011 | 3300021928 | Marine | NALVLDCIKEMREGAKKRKAGIVQTIELQVALKDYDP |
| Ga0063102_10145841 | 3300021941 | Marine | SSKITNQLVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063094_10008731 | 3300021943 | Marine | SSKITNALVLECITTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0063755_10822221 | 3300021954 | Marine | ITNALVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP |
| Ga0228694_1153991 | 3300023567 | Seawater | MSSKITNTGVVENIKNMREKSKARKFKQTVELQVGIKDYDP |
| Ga0228681_10164751 | 3300023683 | Seawater | KMSKISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP |
| Ga0228684_10559511 | 3300023704 | Seawater | NALVLDCIKEMREKSKKERKFKETVELQIALKDYDP |
| Ga0247591_10717232 | 3300026434 | Seawater | KITNALVLDCIKEMREKSKKERKFKETVELQIALKDYDP |
| Ga0247594_10410072 | 3300026448 | Seawater | SSKITNTGVVENIKNMREKSKARKFKQTVELQVGIKDYDP |
| Ga0247600_10335681 | 3300026461 | Seawater | ISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP |
| Ga0247588_11004301 | 3300026465 | Seawater | TNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP |
| Ga0247603_10345941 | 3300026468 | Seawater | KISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP |
| Ga0247599_11235661 | 3300026470 | Seawater | ITNALVLDCIKEMREKSKKERKFKETVELQIALKDYDP |
| Ga0247571_10668542 | 3300026495 | Seawater | MSSKITNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP |
| Ga0247571_11585342 | 3300026495 | Seawater | DKMSKISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP |
| Ga0247592_10752991 | 3300026500 | Seawater | MSSKIANSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP |
| Ga0247605_10789041 | 3300026503 | Seawater | SMSSKITNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP |
| Ga0209499_11443081 | 3300027712 | Freshwater Lake | MASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP |
| Ga0247582_10865261 | 3300028109 | Seawater | ESMSSKITNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP |
| Ga0256413_11727772 | 3300028282 | Seawater | SSKITNTHTLQCIEAMRKKTKERKFKQTIELQVGIKDYDP |
| Ga0304731_116719712 | 3300028575 | Marine | SKITNALVLECIDDMRKKTKERKFAQTVELQVALKDYDP |
| Ga0307401_101743732 | 3300030670 | Marine | TSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP |
| Ga0307401_101823441 | 3300030670 | Marine | NMTTQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP |
| Ga0307401_102516241 | 3300030670 | Marine | KITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP |
| Ga0307398_102767511 | 3300030699 | Marine | GMSSKITNALVLECIKKMKEGTKKRNFTQTVELQVALKDYDP |
| Ga0307399_102581831 | 3300030702 | Marine | RMSSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP |
| Ga0307388_106883981 | 3300031522 | Marine | TQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP |
| Ga0307386_105028891 | 3300031710 | Marine | VMSSKITNTQTLDCITAMRKKTKERKFKQTVELQVGIKDYDP |
| Ga0307381_101163171 | 3300031725 | Marine | KITNQLVLDSIADMRGKTKERKFLQTVELQVALKDYDP |
| Ga0307397_101790682 | 3300031734 | Marine | FCFKIQMTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP |
| Ga0307383_101838113 | 3300031739 | Marine | TTQKITNQLVLDSIADMRGKTKERKFLQTVELQVALKDYDP |
| Ga0307383_102811121 | 3300031739 | Marine | KITNTQTLDCITAMRKKTKERKFKQTVELQVGIKDYDP |
| Ga0307383_104151881 | 3300031739 | Marine | MSSKITNKIVLEAIESMKEATKKRKFTQTVELQVAIKDYDP |
| Ga0307395_101700881 | 3300031742 | Marine | MTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP |
| Ga0307395_103718561 | 3300031742 | Marine | SKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP |
| Ga0314779_10124723 | 3300032150 | Sediment | ATSSKITNAQVLECIKEMREGTKARKFQQTVELQISLKDYDP |
| Ga0314689_104698382 | 3300032518 | Seawater | SKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0314680_103432402 | 3300032521 | Seawater | VMSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0314685_104994611 | 3300032651 | Seawater | KVMSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0314686_103658381 | 3300032714 | Seawater | NSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| Ga0314701_103282451 | 3300032746 | Seawater | MSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP |
| ⦗Top⦘ |