


| Basic Information | |
|---|---|
| Family ID | F090457 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 43 residues |
| Representative Sequence | QFAKVSGVASPGTPQDYAAFLAAEQAKWSRVVSAIGFKEN |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 98.15 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.926 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.815 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.889 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF02698 | DUF218 | 11.11 |
| PF03401 | TctC | 10.19 |
| PF13279 | 4HBT_2 | 9.26 |
| PF01594 | AI-2E_transport | 8.33 |
| PF05762 | VWA_CoxE | 5.56 |
| PF01546 | Peptidase_M20 | 4.63 |
| PF02627 | CMD | 3.70 |
| PF00903 | Glyoxalase | 3.70 |
| PF03328 | HpcH_HpaI | 3.70 |
| PF00990 | GGDEF | 2.78 |
| PF05035 | DGOK | 1.85 |
| PF02826 | 2-Hacid_dh_C | 1.85 |
| PF00246 | Peptidase_M14 | 1.85 |
| PF12848 | ABC_tran_Xtn | 0.93 |
| PF07687 | M20_dimer | 0.93 |
| PF12681 | Glyoxalase_2 | 0.93 |
| PF11294 | DUF3095 | 0.93 |
| PF01425 | Amidase | 0.93 |
| PF08238 | Sel1 | 0.93 |
| PF04392 | ABC_sub_bind | 0.93 |
| PF16326 | ABC_tran_CTD | 0.93 |
| PF02545 | Maf | 0.93 |
| PF11141 | DUF2914 | 0.93 |
| PF03737 | RraA-like | 0.93 |
| PF04290 | DctQ | 0.93 |
| PF11533 | DUF3225 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 11.11 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 11.11 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 10.19 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 8.33 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 3.70 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 3.70 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 3.70 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 3.70 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 3.70 |
| COG3734 | 2-keto-3-deoxy-galactonokinase | Carbohydrate transport and metabolism [G] | 1.85 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.85 % |
| Unclassified | root | N/A | 23.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100130740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 675 | Open in IMG/M |
| 3300004463|Ga0063356_106438225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300004480|Ga0062592_100563118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300005177|Ga0066690_10854525 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005184|Ga0066671_10652933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300005206|Ga0068995_10032385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300005353|Ga0070669_101498105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005444|Ga0070694_100221293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300005450|Ga0066682_10398802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300005451|Ga0066681_10075546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1890 | Open in IMG/M |
| 3300005457|Ga0070662_100404447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
| 3300005543|Ga0070672_100757666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300005561|Ga0066699_10315597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300005574|Ga0066694_10326368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 729 | Open in IMG/M |
| 3300005576|Ga0066708_10441003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300005615|Ga0070702_100222423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300006032|Ga0066696_10772573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300006046|Ga0066652_100634457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1011 | Open in IMG/M |
| 3300006058|Ga0075432_10448400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300006358|Ga0068871_100318942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1368 | Open in IMG/M |
| 3300006845|Ga0075421_101696280 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006846|Ga0075430_100289027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1356 | Open in IMG/M |
| 3300006871|Ga0075434_101162003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300006876|Ga0079217_11227731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300006894|Ga0079215_11279538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 565 | Open in IMG/M |
| 3300006954|Ga0079219_11282760 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300007004|Ga0079218_10771547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
| 3300007076|Ga0075435_100856245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300009012|Ga0066710_104411108 | Not Available | 526 | Open in IMG/M |
| 3300009089|Ga0099828_11546790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300009137|Ga0066709_103305568 | Not Available | 587 | Open in IMG/M |
| 3300009147|Ga0114129_12950422 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009162|Ga0075423_10981855 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300009553|Ga0105249_10382797 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300009803|Ga0105065_1018171 | Not Available | 808 | Open in IMG/M |
| 3300010301|Ga0134070_10343992 | Not Available | 577 | Open in IMG/M |
| 3300010320|Ga0134109_10063002 | Not Available | 1245 | Open in IMG/M |
| 3300010326|Ga0134065_10406968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300010335|Ga0134063_10286941 | Not Available | 789 | Open in IMG/M |
| 3300010403|Ga0134123_11211786 | Not Available | 786 | Open in IMG/M |
| 3300011403|Ga0137313_1050080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300011413|Ga0137333_1050954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300011421|Ga0137462_1106451 | Not Available | 670 | Open in IMG/M |
| 3300011430|Ga0137423_1017954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2198 | Open in IMG/M |
| 3300011443|Ga0137457_1076407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300012022|Ga0120191_10106655 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012159|Ga0137344_1005267 | Not Available | 1796 | Open in IMG/M |
| 3300012203|Ga0137399_10138740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1930 | Open in IMG/M |
| 3300012207|Ga0137381_11530155 | Not Available | 559 | Open in IMG/M |
| 3300012469|Ga0150984_100415543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300012512|Ga0157327_1070955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300012683|Ga0137398_10952640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300014326|Ga0157380_10033906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3934 | Open in IMG/M |
| 3300014877|Ga0180074_1082353 | Not Available | 711 | Open in IMG/M |
| 3300014878|Ga0180065_1039423 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 998 | Open in IMG/M |
| 3300015054|Ga0137420_1007415 | Not Available | 597 | Open in IMG/M |
| 3300015054|Ga0137420_1231927 | Not Available | 736 | Open in IMG/M |
| 3300015054|Ga0137420_1281294 | Not Available | 1070 | Open in IMG/M |
| 3300015255|Ga0180077_1071913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300018027|Ga0184605_10045946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1846 | Open in IMG/M |
| 3300018060|Ga0187765_10219713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1106 | Open in IMG/M |
| 3300018083|Ga0184628_10046220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2192 | Open in IMG/M |
| 3300018429|Ga0190272_12146651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300019257|Ga0180115_1109900 | Not Available | 529 | Open in IMG/M |
| 3300020146|Ga0196977_1088400 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300020150|Ga0187768_1126936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300020202|Ga0196964_10512044 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300020202|Ga0196964_10613385 | Not Available | 536 | Open in IMG/M |
| 3300020202|Ga0196964_10683766 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300020215|Ga0196963_10211300 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300021363|Ga0193699_10023383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2272 | Open in IMG/M |
| 3300024347|Ga0179591_1254219 | Not Available | 4384 | Open in IMG/M |
| 3300025900|Ga0207710_10482300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 642 | Open in IMG/M |
| 3300025906|Ga0207699_10471515 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300025910|Ga0207684_11281718 | Not Available | 604 | Open in IMG/M |
| 3300025912|Ga0207707_10899118 | Not Available | 732 | Open in IMG/M |
| 3300025917|Ga0207660_11394756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300025918|Ga0207662_11288703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300025931|Ga0207644_10468019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1037 | Open in IMG/M |
| 3300025935|Ga0207709_10102269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1897 | Open in IMG/M |
| 3300025936|Ga0207670_10205279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1499 | Open in IMG/M |
| 3300025940|Ga0207691_10156058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2004 | Open in IMG/M |
| 3300026297|Ga0209237_1025754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3284 | Open in IMG/M |
| 3300026325|Ga0209152_10202175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300026532|Ga0209160_1264679 | Not Available | 584 | Open in IMG/M |
| 3300027360|Ga0209969_1037209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300027614|Ga0209970_1115558 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027671|Ga0209588_1050486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
| 3300027681|Ga0208991_1058625 | Not Available | 1162 | Open in IMG/M |
| 3300027787|Ga0209074_10265569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300027876|Ga0209974_10245134 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027886|Ga0209486_10520819 | Not Available | 742 | Open in IMG/M |
| 3300027886|Ga0209486_10872341 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028590|Ga0247823_10794621 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031226|Ga0307497_10005816 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
| 3300031548|Ga0307408_101298738 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031562|Ga0310886_10359307 | Not Available | 849 | Open in IMG/M |
| 3300031731|Ga0307405_10576483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300031740|Ga0307468_100676555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300031858|Ga0310892_10456135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300031901|Ga0307406_11952437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300032002|Ga0307416_103680162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300032005|Ga0307411_11478036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300032144|Ga0315910_11313565 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032144|Ga0315910_11475853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300032180|Ga0307471_100939357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1032 | Open in IMG/M |
| 3300033475|Ga0310811_10538641 | Not Available | 1203 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.26% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 4.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1001307401 | 3300000955 | Soil | AVAEQFAKVGGLASPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQTQ* |
| Ga0063356_1064382252 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DEQFAKVGGIAAPTTPQEYQRFIASEQAKWSKIVQAIGFKE* |
| Ga0062592_1005631183 | 3300004480 | Soil | AAALAALKSKAVQEQFSKVGGIASPGTPQEYQAFIAAEQAKWSRIVQAIGFKE* |
| Ga0066690_108545252 | 3300005177 | Soil | SRAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSKIVAAIGFKE* |
| Ga0066671_106529332 | 3300005184 | Soil | AALKSNAVIEQMAKVGGVASPTTPQEYAKFVEAEQEKWGRIVTAIGFKEQN* |
| Ga0068995_100323851 | 3300005206 | Natural And Restored Wetlands | KSAAVAEQFAKVGGTASPNTPQEYAAFLAAEQEKWGRVVQAIGFKE* |
| Ga0070669_1014981051 | 3300005353 | Switchgrass Rhizosphere | AVTEQFAKVGGLASPGTPQDYAAFLAKAQEKWSRVVNAIGFKEQNQ* |
| Ga0070694_1002212931 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KAVDEQFAKVGGIAAPTTSQEYQSFIAAEQAKWSKIVTAIGFKE* |
| Ga0066682_103988022 | 3300005450 | Soil | RSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSTIGFKEN* |
| Ga0066681_100755463 | 3300005451 | Soil | ALRSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSTIGFKEN* |
| Ga0070662_1004044472 | 3300005457 | Corn Rhizosphere | VDEQFAKVGGIAAPTTSQEYQSFIAAEQAKWSKIVTAIGFKE* |
| Ga0070672_1007576661 | 3300005543 | Miscanthus Rhizosphere | VTEQFAKVGGLASPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQNQ* |
| Ga0066699_103155971 | 3300005561 | Soil | EQFARVSGVASPGTPQDYAAFLAAEQARWSKIVAAIGFKE* |
| Ga0066694_103263681 | 3300005574 | Soil | GVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEH* |
| Ga0066708_104410031 | 3300005576 | Soil | LKSHKLPGTPQDYAKFLAAEQAKWGPIVTAIGFKEQN* |
| Ga0070702_1002224231 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EQFAKVGGLASPGTPQDYAEFLAKEQAKWSRVVSAIGFKEQNQ* |
| Ga0066696_107725732 | 3300006032 | Soil | KVGGVASPTTPQEYAKFIETEQAKWGRIVTAIGFKEQN* |
| Ga0066652_1006344571 | 3300006046 | Soil | KVGGVASPTTPQEYAKFVEAEQEKWGRIVTAIGFKEQN* |
| Ga0075432_104484001 | 3300006058 | Populus Rhizosphere | HAAATNALRSAAVMEQYSKVGGIASPSSPRDYAMFIAAEQAKWSRIVTAIGFKE* |
| Ga0068871_1003189421 | 3300006358 | Miscanthus Rhizosphere | LKSPAVTEQFAKVGGLASPGTPQDYAEFLAKEQAKWSRVVSAIGFKEQNQ* |
| Ga0075421_1016962801 | 3300006845 | Populus Rhizosphere | GGIASPTTPQDYVAFIAAEQAKWSKIVQAIGFKE* |
| Ga0075430_1002890273 | 3300006846 | Populus Rhizosphere | GGIAAPGTPQEYAAFLAAEQAKWSKLVAAIGFKEQTQ* |
| Ga0075434_1011620032 | 3300006871 | Populus Rhizosphere | FASVSAIVSPGTPQEYAAFLAGEQAKWSKVVNAIGFKEAVQ* |
| Ga0079217_112277311 | 3300006876 | Agricultural Soil | SGIASPGTPQDYAAFLAAEQAKWSKVVQAIGFKE* |
| Ga0079215_112795381 | 3300006894 | Agricultural Soil | TEQYAKVGGLASPGTPQEYAAFLEREQAKWSKVVNAIGFKEQN* |
| Ga0079219_112827602 | 3300006954 | Agricultural Soil | QFAKVGGVASPSSPQEYAKFLEAEQAKWGKVVNAIGFKEQN* |
| Ga0079218_107715471 | 3300007004 | Agricultural Soil | KVSGVASPGTPQDYAAFLAAEQAKWSKIVQAIGFKE* |
| Ga0075435_1008562451 | 3300007076 | Populus Rhizosphere | SKLKDQYANVGGVASPGTPQEYAAFLSAEQAKWSKIVAAIGFKEQQQ* |
| Ga0066710_1044111082 | 3300009012 | Grasslands Soil | SGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN |
| Ga0099828_115467901 | 3300009089 | Vadose Zone Soil | VASPGTPQDYAKFLETEQAKWGKVVSAIGFKEQN* |
| Ga0066709_1033055681 | 3300009137 | Grasslands Soil | ALRSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN* |
| Ga0114129_129504222 | 3300009147 | Populus Rhizosphere | VAEQFAKVGGLASPGTPQEYAAFLATEQVKWNKVVTAIGFKEQN* |
| Ga0075423_109818552 | 3300009162 | Populus Rhizosphere | LKSPAVTEQFAKVGGLASPGTPQEYASFLAKEQEKWSRVVSAIGFKEQN* |
| Ga0105249_103827974 | 3300009553 | Switchgrass Rhizosphere | ASAALRSKPLNDQFAAVSAIPSPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQNQ* |
| Ga0105065_10181712 | 3300009803 | Groundwater Sand | VGGIAAPTSSQDYAAFIASEQAKWSRIVTAIGFKE* |
| Ga0134070_103439921 | 3300010301 | Grasslands Soil | QFGKVSGVAAPGTPQEYASFLAGEQAKWSKIVSAIGFKEEN* |
| Ga0134109_100630021 | 3300010320 | Grasslands Soil | ATTALRSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSTIGFKEN* |
| Ga0134065_104069682 | 3300010326 | Grasslands Soil | VAAPGTPQDYAKFLETEQAKWGKVVTAIGFKEQN* |
| Ga0134063_102869412 | 3300010335 | Grasslands Soil | ALRSPAVIEQFAKVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN* |
| Ga0134123_112117862 | 3300010403 | Terrestrial Soil | SNSLAATYANVGGIASPGTPEEYAAFLEDEQDKWRKVVNAIGFKEGS* |
| Ga0137313_10500801 | 3300011403 | Soil | VGGLASPGTPQDYAAFLAREQEKWSRVVSAIGFKEQNQ* |
| Ga0137333_10509541 | 3300011413 | Soil | AKAGEEEFGKVGGGGSPGKPPGYQSFIAAEQAKWSKIVQAIGFKE* |
| Ga0137462_11064512 | 3300011421 | Soil | ALQSSSLREQYAKIGGIASPGTPQEYAAFLAAEQAKWSKVVAAIGFKEQTQ* |
| Ga0137423_10179541 | 3300011430 | Soil | EQFSKVGGIAAPTTPQDYVAFIAAEQAKWSKVVQAIGFKE* |
| Ga0137457_10764073 | 3300011443 | Soil | KVGGIASPTSPQDYQSFIAAEQAKWSKIVQAIGFKE* |
| Ga0120191_101066552 | 3300012022 | Terrestrial | MKMCVENAVDEQFAKVGGIASPGTPQEYQSFIAAEQAKWSKIVQAIGFKE* |
| Ga0137344_10052671 | 3300012159 | Soil | QFAKVGGIASPGTPQEYQSFIAAEQAKWSRIVTAIGFKE* |
| Ga0137399_101387404 | 3300012203 | Vadose Zone Soil | VAAPSTPQDYAKFVEGEQAKWGRIVNAIGFKEQN* |
| Ga0137381_115301552 | 3300012207 | Vadose Zone Soil | PAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEH* |
| Ga0150984_1004155432 | 3300012469 | Avena Fatua Rhizosphere | ASPGTPQDYAAFLAKEQEKWSRVVSAIGFKEQNQ* |
| Ga0157327_10709551 | 3300012512 | Arabidopsis Rhizosphere | QFAKVGGVASPGTPQDYAAFLAKEQEKWSRVVSAIGFKEQVQ* |
| Ga0137398_109526402 | 3300012683 | Vadose Zone Soil | IAQFEKVGGVASPGTPQDYAAFVAAEQAKWSRIVDAIGFKE* |
| Ga0137397_112479541 | 3300012685 | Vadose Zone Soil | KVAGVASPSSPQECAQFVEREQAKWGKIVKAIGIRVD* |
| Ga0157380_100339061 | 3300014326 | Switchgrass Rhizosphere | EQFAKVGGIAAPTTPQEYAAFIAAEQAKWSKIVNAIGFKE* |
| Ga0180074_10823531 | 3300014877 | Soil | LMERYAKVGGIASPGSPQDYAAFIAAEQAKWSKVVTAIGFKE* |
| Ga0180065_10394231 | 3300014878 | Soil | EQYAKIGGIAAPGTPQEYAAFLAAEQAKWSKVVAAIGFKEQTQ* |
| Ga0137420_10074151 | 3300015054 | Vadose Zone Soil | DDGAALASRAVIEQFARVSGVASPGTPHDYAAFLAAEQAKWSQVVSAIGFKEN* |
| Ga0137420_12319271 | 3300015054 | Vadose Zone Soil | RSRIAWHTPHDYAAFLAAEQAKWSKVVSAIGFKEN* |
| Ga0137420_12812942 | 3300015054 | Vadose Zone Soil | ARVSGVASPGTPHDYAAFLAAEQAKWSKVVSAIGFKEN* |
| Ga0180077_10719132 | 3300015255 | Soil | ALKSKAVEEQFAKVGGVASPGTPQEYQSFIAAEQAKWSRIVTAIGFKE* |
| Ga0184605_100459461 | 3300018027 | Groundwater Sediment | KSGAVAEQFAKVGGLASPGTPQDYAAFLAHEQAKWSRIVTAIGFKEQN |
| Ga0187765_102197131 | 3300018060 | Tropical Peatland | EQFAKVGGVASPSTQEEYAKFLAGEQAKWSKIVQAIGFKEE |
| Ga0184628_100462204 | 3300018083 | Groundwater Sediment | VAALQSSNLKEQYLRVGGVASPGTPQEYAAFLAAEQEKWSKVVVAIGFKEQTQ |
| Ga0190272_121466511 | 3300018429 | Soil | KVGGLASPGTPQEYAAFLAAEQAKWSKVVTAIGFKEQN |
| Ga0180115_11099002 | 3300019257 | Groundwater Sediment | LASPGTPQEYAAFLAAEQAKWSKVVAAIGFKEQTQ |
| Ga0196977_10884001 | 3300020146 | Soil | AVEEQFAKVGGIASPGTPQDYARFIAAEQAKWSRIVQAIGFKE |
| Ga0187768_11269362 | 3300020150 | Tropical Peatland | RDPTLVERFARISAVPSPGTPEDYAAFLAAEQAKWSKIVAAIGFRE |
| Ga0196964_105120442 | 3300020202 | Soil | SKPVEEQFSKVGGIASPGTPQEYAAFIAAEQAKWSRIVQAIGFKE |
| Ga0196964_106133852 | 3300020202 | Soil | LAALKSKPIEEQFSKVGGIASPGTPQQYAAFIAAEQAKWSKIVQAIGFKE |
| Ga0196964_106837662 | 3300020202 | Soil | KPVEEQLSKVGGIASPTTPQEYAAFIAAEQAKWSKIVQAIGFKE |
| Ga0196963_102113001 | 3300020215 | Soil | AVAALRSKPVEEQFSKVGGIASPGTPQEYAAFIASEQAKWSKIVQAIGFKE |
| Ga0193699_100233833 | 3300021363 | Soil | KLHAAAVTALQSASLKDQYSKVGGIASPGSPQDFAAFLAAEQTKWSQVVSAIGFKEQTQ |
| Ga0179591_12542191 | 3300024347 | Vadose Zone Soil | QFARVGGVAMPGSPQDFAAFLAAEQTKWSKVVTAIGFKEQTQ |
| Ga0207710_104823001 | 3300025900 | Switchgrass Rhizosphere | PAIKEQYAKVGGIASPGTPQDYAAFLAAEQAKWSKVVEAIGFKEQTQ |
| Ga0207699_104715153 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGVAAPSTPQEYATFLGAEQAKWSKIVQAIGFKEEN |
| Ga0207684_112817182 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | HAAAMTALRSHAVVEQFARVSGVASPGTPQDYAAFLAAEQAKWSKVVSAIGFKEN |
| Ga0207707_108991182 | 3300025912 | Corn Rhizosphere | QYAKVAGVASPGSPEDYAKFLAAEQAKWSQVVTAIGFKQQN |
| Ga0207660_113947561 | 3300025917 | Corn Rhizosphere | AVDEQFAKVGGIAAPTTPQEYAAFIAAEQAKWSKIVNAIGFKE |
| Ga0207662_112887031 | 3300025918 | Switchgrass Rhizosphere | AVTEQFAKVGGLASPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQNQ |
| Ga0207644_104680192 | 3300025931 | Switchgrass Rhizosphere | SKAVEDQFAKVGGIPSPTTPQEYAHFVETEQAKWGKVVTAIGFKENN |
| Ga0207709_101022691 | 3300025935 | Miscanthus Rhizosphere | DEQFAKVGGIAAPTTSQEYQSFIAAEQAKWSKIVTAIGFKE |
| Ga0207670_102052793 | 3300025936 | Switchgrass Rhizosphere | QFAKVGGIAAPTTPQEYAAFIAAEQAKWSKIVNAIGFKE |
| Ga0207691_101560581 | 3300025940 | Miscanthus Rhizosphere | VAALKSKTVDEQFAKVGGIAAPSTPQEYQSFIAAEQAKWSKIVTAIGFKE |
| Ga0209237_10257541 | 3300026297 | Grasslands Soil | AVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN |
| Ga0209152_102021751 | 3300026325 | Soil | FARVSGVASPGTPQDYAAFLAAEQARWSKIVAAIGFKE |
| Ga0209160_12646792 | 3300026532 | Soil | QFAKVSGVASPGTPQDYAAFLAAEQAKWSRVVSAIGFKEN |
| Ga0209969_10372092 | 3300027360 | Arabidopsis Thaliana Rhizosphere | ALRSKAVDETFAKVGGIASPGTPQEYQAFIAAEQAKWSKIVQAIGFKE |
| Ga0209970_11155582 | 3300027614 | Arabidopsis Thaliana Rhizosphere | KVGGIASPGTPQEYQAFIAAEQAKWSRIVQAIGFKE |
| Ga0209588_10504863 | 3300027671 | Vadose Zone Soil | RSPALTEQYSNVSGEASPGTPQDYASFLAAEQAKWSRIVDAIGFRE |
| Ga0208991_10586252 | 3300027681 | Forest Soil | EQFAKVSGVASPGTPQDYASFLAAEQAKWSQVVSAIGFKEN |
| Ga0209074_102655691 | 3300027787 | Agricultural Soil | FAKVGGVASPTTPQEYAKFIETEQAKWGRIVTAIGFKEQN |
| Ga0209974_102451343 | 3300027876 | Arabidopsis Thaliana Rhizosphere | LKSKAVQEQFSKVGGIASPGTPQEYQAFIAAEQAKWSRIVQAIGFKE |
| Ga0209486_105208191 | 3300027886 | Agricultural Soil | GGIAAGGSPQDYAAFLASEQAKWSKVVTAIGFKEQTQ |
| Ga0209486_108723412 | 3300027886 | Agricultural Soil | KVGGIAAPGTPQEYAAFIAAEQAKWSKIVQAIGFKE |
| Ga0247823_107946213 | 3300028590 | Soil | VSGVPSPGTPEDYARFLAAEQAKWSKVVSAIGFKN |
| Ga0307497_100058161 | 3300031226 | Soil | GGLASPGTPQDYAAFLAREQEKWSRVVSAIGFKEQNQ |
| Ga0307408_1012987382 | 3300031548 | Rhizosphere | EEQFSKVGGIASPTTPQQYAAFIASEQAKWSKIVQAIGFKE |
| Ga0310886_103593071 | 3300031562 | Soil | SKVGGIASPGSPQDYAAFLASEQAKWSAVVTAIGFKEQTQ |
| Ga0307405_105764831 | 3300031731 | Rhizosphere | KVGGIASPTSPQDYQRFIAAEQTKWSKIVQAIGFKE |
| Ga0307468_1006765551 | 3300031740 | Hardwood Forest Soil | AVVEQFGKVSGVAAPGTPQDYASFLAAEQAKWSKVVTAIGFKEEN |
| Ga0310892_104561351 | 3300031858 | Soil | FAKVGGIAAPGTPQEYAAFIAAEQAKWSKIVTAIGFKE |
| Ga0307406_119524373 | 3300031901 | Rhizosphere | LKSKAVDEQFAKVGGIASPGTPQEYAAFIAAEQAKWSKIVQAIGFKE |
| Ga0307416_1036801622 | 3300032002 | Rhizosphere | HAAAMASLKSAAVMEQFAKVGGLASPGTPQEYASFLASEQAKWSKVVTAIGFKEQN |
| Ga0307411_114780361 | 3300032005 | Rhizosphere | AALKSKAVDEQFSKVGGIASPTSPQDYQRFIAAEQAKWSKIVQAIGFKE |
| Ga0315910_113135652 | 3300032144 | Soil | EEQFSKVGGIASPGTPQDYQAFIAAEQAKWSRIVQAIGFKE |
| Ga0315910_114758531 | 3300032144 | Soil | AAVAALKSKAVDEQFAKVGGIAAPTTPQEYQRFVAAEQGKWSKIVQAIGFKE |
| Ga0307471_1009393572 | 3300032180 | Hardwood Forest Soil | GIAFPGTPQDYAAFLAAEQAKWSKVVTAIGFKEQN |
| Ga0310811_105386411 | 3300033475 | Soil | QLVEQYAKVAGIASPGSPQDYAAFLAREQAKWREVVTAIGFKEQN |
| ⦗Top⦘ |