


| Basic Information | |
|---|---|
| Family ID | F090346 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MWNVEERFSPKAIESLAALGFAVGSTRGVVRVEKYGCG |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.44 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 86.11 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.370 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.704 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.185 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.64% β-sheet: 18.18% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 25.93 |
| PF13620 | CarboxypepD_reg | 15.74 |
| PF00899 | ThiF | 14.81 |
| PF04773 | FecR | 2.78 |
| PF09360 | zf-CDGSH | 2.78 |
| PF06271 | RDD | 1.85 |
| PF12840 | HTH_20 | 1.85 |
| PF14464 | Prok-JAB | 0.93 |
| PF13211 | DUF4019 | 0.93 |
| PF05768 | Glrx-like | 0.93 |
| PF09862 | DUF2089 | 0.93 |
| PF13414 | TPR_11 | 0.93 |
| PF00990 | GGDEF | 0.93 |
| PF13358 | DDE_3 | 0.93 |
| PF00857 | Isochorismatase | 0.93 |
| PF04973 | NMN_transporter | 0.93 |
| PF02597 | ThiS | 0.93 |
| PF01797 | Y1_Tnp | 0.93 |
| PF13407 | Peripla_BP_4 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 1.85 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.93 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.93 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.93 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.93 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.37 % |
| Unclassified | root | N/A | 29.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101364309 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105043482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300000789|JGI1027J11758_12357402 | Not Available | 504 | Open in IMG/M |
| 3300005332|Ga0066388_100716604 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300005538|Ga0070731_11101318 | Not Available | 525 | Open in IMG/M |
| 3300005602|Ga0070762_10076653 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300005618|Ga0068864_101944933 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005843|Ga0068860_102181126 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006606|Ga0074062_11887379 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006881|Ga0068865_100482980 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300007255|Ga0099791_10234505 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300007265|Ga0099794_10031613 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300007788|Ga0099795_10293210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300009012|Ga0066710_101619034 | Not Available | 991 | Open in IMG/M |
| 3300009012|Ga0066710_101726104 | Not Available | 951 | Open in IMG/M |
| 3300009638|Ga0116113_1087537 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300009700|Ga0116217_10216881 | Not Available | 1252 | Open in IMG/M |
| 3300010047|Ga0126382_10893150 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300010048|Ga0126373_10259904 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300010048|Ga0126373_10518150 | Not Available | 1237 | Open in IMG/M |
| 3300010159|Ga0099796_10581659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300010329|Ga0134111_10154710 | Not Available | 909 | Open in IMG/M |
| 3300010329|Ga0134111_10352686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300010337|Ga0134062_10481605 | Not Available | 621 | Open in IMG/M |
| 3300010358|Ga0126370_10061121 | Not Available | 2446 | Open in IMG/M |
| 3300010358|Ga0126370_10179716 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300010359|Ga0126376_11621907 | Not Available | 680 | Open in IMG/M |
| 3300010361|Ga0126378_12637559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300010366|Ga0126379_13182748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010403|Ga0134123_11751619 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300011269|Ga0137392_10451315 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300012096|Ga0137389_11180820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300012096|Ga0137389_11305376 | Not Available | 619 | Open in IMG/M |
| 3300012189|Ga0137388_10175907 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300012198|Ga0137364_10099513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2044 | Open in IMG/M |
| 3300012202|Ga0137363_10030828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 3703 | Open in IMG/M |
| 3300012203|Ga0137399_10426169 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300012205|Ga0137362_10036709 | All Organisms → cellular organisms → Bacteria | 3921 | Open in IMG/M |
| 3300012205|Ga0137362_11181566 | Not Available | 649 | Open in IMG/M |
| 3300012209|Ga0137379_10316038 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012211|Ga0137377_11250379 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300012211|Ga0137377_11875466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012357|Ga0137384_11273347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300012361|Ga0137360_10012278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5496 | Open in IMG/M |
| 3300012361|Ga0137360_10368249 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300012924|Ga0137413_10217536 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300012927|Ga0137416_10023844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3967 | Open in IMG/M |
| 3300012929|Ga0137404_10113947 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300012929|Ga0137404_10892406 | Not Available | 810 | Open in IMG/M |
| 3300012931|Ga0153915_12670188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300012971|Ga0126369_10569748 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300014501|Ga0182024_12107945 | Not Available | 620 | Open in IMG/M |
| 3300015053|Ga0137405_1315660 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
| 3300015054|Ga0137420_1205280 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300016294|Ga0182041_10085186 | Not Available | 2273 | Open in IMG/M |
| 3300016404|Ga0182037_10445554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
| 3300017932|Ga0187814_10282994 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300017934|Ga0187803_10436242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300017937|Ga0187809_10050008 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300017972|Ga0187781_10847629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300017995|Ga0187816_10252003 | Not Available | 770 | Open in IMG/M |
| 3300018086|Ga0187769_10776679 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300018088|Ga0187771_10263951 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300018088|Ga0187771_10286425 | Not Available | 1379 | Open in IMG/M |
| 3300020170|Ga0179594_10192490 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300020199|Ga0179592_10100359 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300020199|Ga0179592_10136224 | Not Available | 1126 | Open in IMG/M |
| 3300020199|Ga0179592_10147920 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300020199|Ga0179592_10343881 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300020580|Ga0210403_10132373 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300020580|Ga0210403_10686246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300020582|Ga0210395_10251182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300021405|Ga0210387_11864909 | Not Available | 505 | Open in IMG/M |
| 3300021420|Ga0210394_11445357 | Not Available | 583 | Open in IMG/M |
| 3300021477|Ga0210398_10156455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300021478|Ga0210402_10106297 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300022873|Ga0224550_1006057 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300025812|Ga0208457_1045705 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300025900|Ga0207710_10479563 | Not Available | 644 | Open in IMG/M |
| 3300025905|Ga0207685_10485919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300026281|Ga0209863_10040469 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300026490|Ga0257153_1012732 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300026823|Ga0207759_116385 | Not Available | 578 | Open in IMG/M |
| 3300026847|Ga0207802_1008233 | Not Available | 946 | Open in IMG/M |
| 3300026941|Ga0207741_1009894 | Not Available | 1115 | Open in IMG/M |
| 3300027011|Ga0207740_1019360 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300027537|Ga0209419_1031862 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300027583|Ga0209527_1140862 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027654|Ga0209799_1149626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300027681|Ga0208991_1086272 | Not Available | 943 | Open in IMG/M |
| 3300027812|Ga0209656_10411263 | Not Available | 605 | Open in IMG/M |
| 3300027846|Ga0209180_10681713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300027855|Ga0209693_10423193 | Not Available | 642 | Open in IMG/M |
| 3300027867|Ga0209167_10003183 | All Organisms → cellular organisms → Bacteria | 8607 | Open in IMG/M |
| 3300027869|Ga0209579_10594283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300027908|Ga0209006_10411624 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300031708|Ga0310686_115465465 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031718|Ga0307474_10508906 | Not Available | 945 | Open in IMG/M |
| 3300031835|Ga0318517_10544694 | Not Available | 522 | Open in IMG/M |
| 3300031954|Ga0306926_10051257 | All Organisms → cellular organisms → Bacteria | 4938 | Open in IMG/M |
| 3300032001|Ga0306922_10386703 | Not Available | 1499 | Open in IMG/M |
| 3300032174|Ga0307470_11090431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300032180|Ga0307471_102629774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300032261|Ga0306920_100042119 | All Organisms → cellular organisms → Bacteria | 6607 | Open in IMG/M |
| 3300032783|Ga0335079_11529309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300032828|Ga0335080_10670973 | Not Available | 1083 | Open in IMG/M |
| 3300032829|Ga0335070_10390727 | Not Available | 1332 | Open in IMG/M |
| 3300034091|Ga0326724_0384537 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013643091 | 3300000364 | Soil | MWNVDQRFESKAIESLAALGFAVGSTRGVVRVEKYGCG |
| INPhiseqgaiiFebDRAFT_1050434822 | 3300000364 | Soil | MWNVEERFSPKAIEGLAALGFKVGSTRGVVRVEKYGSGAE |
| JGI1027J11758_123574022 | 3300000789 | Soil | MWNVXQRFESKAIESLAALGFAVGSTRGVVRVEKY |
| Ga0066388_1007166041 | 3300005332 | Tropical Forest Soil | MWNVDERFTQKAIESLAALGFGVGSTRGVVRVEKYGCGAE |
| Ga0070731_111013181 | 3300005538 | Surface Soil | MWNVDERFDKKAIDGLAALGFSVGSTRGVVRVEKYGSG |
| Ga0070762_100766531 | 3300005602 | Soil | MWNVEERFTPKQMENLAALGFAVGSTRGVIRVEKYGSG |
| Ga0068864_1019449331 | 3300005618 | Switchgrass Rhizosphere | MWNVEQRFDPKAIEGLAALGFSVGSTRGVVRVEKYGCGA |
| Ga0068860_1021811261 | 3300005843 | Switchgrass Rhizosphere | MWNVEQRFAPKAIEGLAALGFSVGSTRGVVRVEKYGC |
| Ga0074062_118873792 | 3300006606 | Soil | MWNVDERFEKKTLDTLAARGFSVGSTRGVVRVEKY |
| Ga0068865_1004829801 | 3300006881 | Miscanthus Rhizosphere | MWNVEQRFDPKAIEGLAALGFSVGSTRGVVRVEKYGC |
| Ga0099791_102345053 | 3300007255 | Vadose Zone Soil | FSPKAIEGLAALGFAVGSTRGVVRVEKYGCGAECR* |
| Ga0099794_100316135 | 3300007265 | Vadose Zone Soil | MWNVNEKFSQKAIESLAALGFSVGSTRGVVRVEKYGGGA |
| Ga0099795_102932102 | 3300007788 | Vadose Zone Soil | MWNVSERFSQKAIESLAALGFTVGSTRGVVRVEKYGSGA |
| Ga0066710_1016190342 | 3300009012 | Grasslands Soil | MWNVNQRFSQKAIESLAALGFTVGSTRGVVRVEKYGSG |
| Ga0066710_1017261041 | 3300009012 | Grasslands Soil | MWNVEERFSPKAIEGLAALGFKVGSTRGVVRVEKYGC |
| Ga0116113_10875371 | 3300009638 | Peatland | MWNVEDRFAPKAIERLASLGFSVGSTRGVVRVEKYGCGA |
| Ga0116217_102168812 | 3300009700 | Peatlands Soil | MWNVDERFEKKTMDSLAAQGFSVGSTRGVVRVEKYGSGAEFRQV |
| Ga0126382_108931502 | 3300010047 | Tropical Forest Soil | MWNVEQRFDPKAIESLAALGFSVGSTRGVVRVEKYGCG |
| Ga0126373_102599042 | 3300010048 | Tropical Forest Soil | MWNVEERFEKKAMDKLASLGFSVGSTRGVVRVEKYGSGAEFRQ |
| Ga0126373_105181502 | 3300010048 | Tropical Forest Soil | MWNVNETFEKKAMDSLAALGFGVGSTRGVVRVEKYGCGAEF |
| Ga0099796_105816591 | 3300010159 | Vadose Zone Soil | MWNVNEKFSQKAIESLAALGFSVGSTRGVVRVEKYGGGAE |
| Ga0134111_101547101 | 3300010329 | Grasslands Soil | MWNVNARFSQKAIESLAALGFTVGSTRGVVRVEKYGSGAE |
| Ga0134111_103526861 | 3300010329 | Grasslands Soil | MWNVTERFAKAAIDALVSYGFSVGSTRGVVRVEKY |
| Ga0134062_104816052 | 3300010337 | Grasslands Soil | MWNVEERFSPKAIEGLAALGFSVGSTRGVVRVEKYG |
| Ga0126370_100611211 | 3300010358 | Tropical Forest Soil | MWNVDERFEKKAMDTLASLGFSVGSTRGVVRVEKYGSGAEFRQN |
| Ga0126370_101797163 | 3300010358 | Tropical Forest Soil | MWNVEQRFSQRAIESLAALGFTVGSTRGVVRVEKYG |
| Ga0126376_116219071 | 3300010359 | Tropical Forest Soil | MWNVEERFEKKAMDSLAALGFTVGSTRGVVRVEKYGCGAE |
| Ga0126378_126375591 | 3300010361 | Tropical Forest Soil | MWNVEERFSPKAIEGLAALGFAVGSTRGVVRVEKYG |
| Ga0126379_131827481 | 3300010366 | Tropical Forest Soil | MWNVEERFAPKAIESLAALGFTVGSTRGVVRVEKYG |
| Ga0134123_117516193 | 3300010403 | Terrestrial Soil | MWNVEERFTPKQIESLAALGFAVGSTRGVVRVEKYGS |
| Ga0137392_104513151 | 3300011269 | Vadose Zone Soil | MWNVNERFSQKAIESLAALGFGVGSTRGVVRVEKY |
| Ga0137389_111808201 | 3300012096 | Vadose Zone Soil | MWNVEERFSPKAIEGLAALGFKVGSTRGVVRVEKY |
| Ga0137389_113053761 | 3300012096 | Vadose Zone Soil | MWNIEEQFSPRAIESLAALGFAVGSTRGVVRVEKY |
| Ga0137388_101759071 | 3300012189 | Vadose Zone Soil | MWNVNERFSQKAIESLAALGFGVGSTRGVVRVEKYGGGAE |
| Ga0137364_100995131 | 3300012198 | Vadose Zone Soil | MWNVEERFSPKAIESLAALGFAVGSTRGVVRVEKYG |
| Ga0137363_100308283 | 3300012202 | Vadose Zone Soil | MWNIEQRFSPKAIESMAALGFAVGSTRGVVRVEKYGCG |
| Ga0137399_104261692 | 3300012203 | Vadose Zone Soil | MWNVNERFDKKAIDSLAALGFGVGSTRGVVRGEMRLRR* |
| Ga0137362_100367093 | 3300012205 | Vadose Zone Soil | MWNIEQRFSPKAIESMAALGFAVGSTRGVVRVEKYGCGA |
| Ga0137362_111815661 | 3300012205 | Vadose Zone Soil | MWNVNERFDKKAIDSLAALGFGVGSTRGVVRVEKYG |
| Ga0137379_103160383 | 3300012209 | Vadose Zone Soil | MWNIEERFFPKAIESLAALGFAVGSTRGVVRVEKYGSG |
| Ga0137377_112503791 | 3300012211 | Vadose Zone Soil | MWNVEERFDPKAIESLAALGFAVGRTRGVVRVEKYG |
| Ga0137377_118754661 | 3300012211 | Vadose Zone Soil | MWNVEDRFSPKTIESLAALGFAVGSTRGVVRVEKYG |
| Ga0137384_112733472 | 3300012357 | Vadose Zone Soil | MWNVEDRFAPKAIESLAALGFAVGSTRGAVRVEKYGCG |
| Ga0137360_100122781 | 3300012361 | Vadose Zone Soil | MWNVSERFSQKAIESLAALGFTVGSTRGVVRVEKYGSGAEFRL |
| Ga0137360_103682491 | 3300012361 | Vadose Zone Soil | MWNIEERFSPKAIESLAALGFAVGSTRGVVRIEKYG |
| Ga0137413_102175362 | 3300012924 | Vadose Zone Soil | MWNVSERFSQKAIESLAALGFTVGSTRGVVRVEKYG |
| Ga0137416_100238441 | 3300012927 | Vadose Zone Soil | MWNIEQRFSPKAIESMAALGFAVGSTRGVVRVEKYGC |
| Ga0137404_101139471 | 3300012929 | Vadose Zone Soil | MWNVEERFSPKAIEGLAALGFKVGSTRGVVRVEKYGCG |
| Ga0137404_108924061 | 3300012929 | Vadose Zone Soil | MWNVEERFSPKAIEGLAALGFKVGSTRGVVRVEKYGCGA |
| Ga0153915_126701882 | 3300012931 | Freshwater Wetlands | MWNVEERFSPTAIESLAALGFSVGSTRGVVRAEKY |
| Ga0126369_105697483 | 3300012971 | Tropical Forest Soil | MWNVDERFEKTAIESLAALGFSVGATRGVVRVEKYGSGAEFRQG |
| Ga0182024_121079451 | 3300014501 | Permafrost | MWNVNERFDSAVILEKLALLGFQVGSTGGVVRVEKY |
| Ga0137405_13156608 | 3300015053 | Vadose Zone Soil | MWNVEERFSQKAIESLAALGFTVGSTRGVVRVEKYGSGAEFRQDTTANIN* |
| Ga0137420_12052801 | 3300015054 | Vadose Zone Soil | MWNVEERFSPKAIESLAALGFAVGSTRGVVRVEKCREIRLRR |
| Ga0182041_100851864 | 3300016294 | Soil | MWNVDERFEKKAMDTLTSLGFSVGSTRGVVRVEKYGSGAEFR |
| Ga0182037_104455543 | 3300016404 | Soil | MWNIEERFAPKAIESLAALGFTVGSTRGVVRVEKYGC |
| Ga0187814_102829941 | 3300017932 | Freshwater Sediment | MWNVDERFEKKAMDSLASLGFSVGSTRGVVRVEKYGCGA |
| Ga0187803_104362421 | 3300017934 | Freshwater Sediment | MWNVDERFEKKQMDSLAAMGFSVGSTRGVVRVEKYGCG |
| Ga0187809_100500081 | 3300017937 | Freshwater Sediment | MWNVDERFEKKAMDSLASLGFSVGSTRGVVRVEKYGCG |
| Ga0187781_108476291 | 3300017972 | Tropical Peatland | MWNVNERFEKKAMDSLAALGFSVGSTRGVVRVEKYGCG |
| Ga0187816_102520032 | 3300017995 | Freshwater Sediment | MWNVNERFEKKTIDSLAALGFSVGSTRGVVRVEKYG |
| Ga0187769_107766791 | 3300018086 | Tropical Peatland | MWNVDERFEKKQMDGLAALGFSVGSTRGVVRVEKYGCGA |
| Ga0187771_102639514 | 3300018088 | Tropical Peatland | MWNVDERFEASVLEGLPALGFEVNSTRGVMRVEKYGCGAE |
| Ga0187771_102864252 | 3300018088 | Tropical Peatland | MWNVDERFEKKQMDGLAALGFSVGSTRGVVRVEKY |
| Ga0179594_101924902 | 3300020170 | Vadose Zone Soil | MWNVEQKFSPKAIESLAALGFAVGSTRGVVRVEKY |
| Ga0179592_101003591 | 3300020199 | Vadose Zone Soil | MWNVEERFSPKAIESLAALGFAVGSTRGVVRVEKYGCG |
| Ga0179592_101362241 | 3300020199 | Vadose Zone Soil | MWNVEEKFTPKQMENLAALGFAVGSTRGVVRVEKYGSGA |
| Ga0179592_101479202 | 3300020199 | Vadose Zone Soil | MWNVNERFDKKAIDSLAALGFGVGSTRGVVRGEMRLRR |
| Ga0179592_103438811 | 3300020199 | Vadose Zone Soil | MWNVEERFSPKAIESLAALGFAVGSTRGVVRVEKYGC |
| Ga0210403_101323732 | 3300020580 | Soil | MWNVNERFEKKAIDSLAALGFGVGSTRGVVRVEKYGSGAEF |
| Ga0210403_106862461 | 3300020580 | Soil | MWNVDERFEKKTIDTLTAKGFSVGSTRGVVRVEKYGCGAE |
| Ga0210395_102511822 | 3300020582 | Soil | MWNVEQRFTGKQIESLAALGFAVGSTRGVVRVEKYGSG |
| Ga0210387_118649091 | 3300021405 | Soil | MWNVEERFTPKQIEGLAALGFAVGSTRGVVRVEKYG |
| Ga0210394_114453572 | 3300021420 | Soil | MWNVNERFSQKAIENLAALGFRVGSTRGVVRVEKYGS |
| Ga0210398_101564553 | 3300021477 | Soil | MWNVEQRFTGKQIESLAALGFAVGSTRGVVRVEKY |
| Ga0210402_101062974 | 3300021478 | Soil | MWNVNERFDKKAIDSLAALGFGVGSTRGVVRVEKYGSGA |
| Ga0224550_10060573 | 3300022873 | Soil | MWNVEDRFAPKAIEGLAALGFAVGSTRGVVRVEKFGSG |
| Ga0208457_10457052 | 3300025812 | Peatland | MWNVDERFEKKTMDSLAALGFAVGSTRGVVRVEKYGSGAEFRQ |
| Ga0207710_104795632 | 3300025900 | Switchgrass Rhizosphere | MWNVEEKFSPKAIESLAALGFAVGSTRGVVRVEKY |
| Ga0207685_104859192 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMWNVNERFSQKAIESLAALGFSVGSTRGVVRVEKY |
| Ga0209863_100404691 | 3300026281 | Prmafrost Soil | MWNVEERFLPKAIEGLAALGFAVGSTRGVVRVEKYGCG |
| Ga0257153_10127321 | 3300026490 | Soil | MWNVEQRFDPKAIESMAALGFAVGSTRGVVRVEKYGCG |
| Ga0207759_1163851 | 3300026823 | Tropical Forest Soil | MWNVDERFEKKAMDTLTTLGFSVGSTRGVVRVEKYG |
| Ga0207802_10082331 | 3300026847 | Tropical Forest Soil | MWNVDERFEKKAMDTLTSLGFSVGSTRGVVRVEKYGSGAEFRQNP |
| Ga0207741_10098941 | 3300026941 | Tropical Forest Soil | MWNVDERFEKKAMDTLTSLGFSVGSTRGVVRVEKYG |
| Ga0207740_10193603 | 3300027011 | Tropical Forest Soil | MWNVDERFEKKTLDTLAGRGFAVGSTRGVVRVEKYGCGAEL |
| Ga0209419_10318622 | 3300027537 | Forest Soil | MWNIEERFSPKAIEQLAALGFAVGSTRGVVRVEKYGAGAE |
| Ga0209527_11408622 | 3300027583 | Forest Soil | MWNIEERFSPKAIEQLAALGIAVGSTRGVVRVEKYGAGAE |
| Ga0209799_11496261 | 3300027654 | Tropical Forest Soil | MWNVEQRFDPKALEGLAALGFSVGSTRGVVRVEKYG |
| Ga0208991_10862722 | 3300027681 | Forest Soil | MWNIEDRFSPKAIEGLAALGFAVGSTRGVVRVEKY |
| Ga0209656_104112631 | 3300027812 | Bog Forest Soil | MWNVDERFEKKTMDSLAALGFAVGSTRGVVRVEKY |
| Ga0209180_106817132 | 3300027846 | Vadose Zone Soil | MWNVAQRFDPKAIESMAALGFAVGSTRGVVRVEKYG |
| Ga0209693_104231932 | 3300027855 | Soil | MWDVEERFSPRAIESLAALGFAVGSTRGVVRVEKYGSG |
| Ga0209167_100031831 | 3300027867 | Surface Soil | MWDVKERFDTALVLQKLAATAFQVGSTGGVVRVEKYGCASE |
| Ga0209579_105942832 | 3300027869 | Surface Soil | MWDVKERFETSVILEKLAAAGFQVGSTGGVVRVEKY |
| Ga0209006_104116242 | 3300027908 | Forest Soil | MWNVNERFDKKAIDSLAALGFGVGSTRGVVRVEKYGCG |
| Ga0310686_1154654652 | 3300031708 | Soil | MWNVDQRFEKQQMDKLASLGFSVGSTRGVVRVEKYGS |
| Ga0307474_105089061 | 3300031718 | Hardwood Forest Soil | MWNVNERFDAAALETLPSLGFQVSSTRGVVRVEKYGSGAEFRHVQ |
| Ga0318517_105446942 | 3300031835 | Soil | MWNVDERFEKKQMDSLAALGFSVGSTRGVVRVEKYGC |
| Ga0306926_100512578 | 3300031954 | Soil | MWNVDERFEKKQMDRLAGLGFSVGSTRGVVRVEKYGSGAEFR |
| Ga0306922_103867032 | 3300032001 | Soil | MWNVDERFEKKAMDTLTSLGFSVGSTRGVVRVEKYGSGAEFRQNPD |
| Ga0307470_110904311 | 3300032174 | Hardwood Forest Soil | MWNVNERFSQKAIESLAALGFGVGSTRGVVRVEKYGCGA |
| Ga0307471_1026297742 | 3300032180 | Hardwood Forest Soil | MWNVEERFSPKAIESLAALGFAVGSTRGVVRVEKY |
| Ga0306920_1000421198 | 3300032261 | Soil | MWNVDERFEKKAMDTLTSLGFSVGSTRGVVRVEKYGSGAEFRQNPDA |
| Ga0335079_115293092 | 3300032783 | Soil | MLKAVWNINERFDPAILETLPSKGFQVSSTRGVVRVEKYCCGAE |
| Ga0335080_106709731 | 3300032828 | Soil | MWNVDERFEKKQMDKLASLGFSVGSTRGVVRVEKYGCG |
| Ga0335070_103907271 | 3300032829 | Soil | MWNVNERFEKKAMDSLAALGFGVGSTRGVVRVEKYG |
| Ga0326724_0384537_1_117 | 3300034091 | Peat Soil | MWNVDERFEKKTMDSLAALGFAVGSTRGVVRVEKYGSGA |
| ⦗Top⦘ |