


| Basic Information | |
|---|---|
| Family ID | F090268 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSFYHGLGMFFLGMGAIIIGGIIAWYVINKVMEDDEK |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.58 % |
| % of genes near scaffold ends (potentially truncated) | 10.19 % |
| % of genes from short scaffolds (< 2000 bps) | 84.26 % |
| Associated GOLD sequencing projects | 53 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (29.630 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.704 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.111 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 22.22 |
| PF00145 | DNA_methylase | 18.52 |
| PF13759 | 2OG-FeII_Oxy_5 | 9.26 |
| PF14528 | LAGLIDADG_3 | 3.70 |
| PF05063 | MT-A70 | 1.85 |
| PF03592 | Terminase_2 | 1.85 |
| PF00730 | HhH-GPD | 0.93 |
| PF01327 | Pep_deformylase | 0.93 |
| PF14236 | DUF4338 | 0.93 |
| PF12705 | PDDEXK_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 18.52 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 3.70 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.85 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.93 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.93 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.74 % |
| Unclassified | root | N/A | 33.33 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000947|BBAY92_10039741 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300000949|BBAY94_10131329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 682 | Open in IMG/M |
| 3300001945|GOS2241_1017139 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300002488|JGI25128J35275_1023809 | Not Available | 1481 | Open in IMG/M |
| 3300006735|Ga0098038_1007692 | Not Available | 4324 | Open in IMG/M |
| 3300006735|Ga0098038_1087692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1084 | Open in IMG/M |
| 3300006735|Ga0098038_1189567 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006737|Ga0098037_1036739 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300006737|Ga0098037_1038636 | Not Available | 1744 | Open in IMG/M |
| 3300006737|Ga0098037_1161208 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006737|Ga0098037_1300962 | Not Available | 506 | Open in IMG/M |
| 3300006929|Ga0098036_1057520 | Not Available | 1205 | Open in IMG/M |
| 3300006929|Ga0098036_1132606 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006929|Ga0098036_1201694 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300007963|Ga0110931_1170285 | unclassified Hyphomonas → Hyphomonas sp. | 652 | Open in IMG/M |
| 3300008216|Ga0114898_1009226 | All Organisms → Viruses → Predicted Viral | 3922 | Open in IMG/M |
| 3300008216|Ga0114898_1027513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1927 | Open in IMG/M |
| 3300008217|Ga0114899_1209947 | Not Available | 614 | Open in IMG/M |
| 3300008220|Ga0114910_1204615 | Not Available | 542 | Open in IMG/M |
| 3300009413|Ga0114902_1088903 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009413|Ga0114902_1099105 | Not Available | 778 | Open in IMG/M |
| 3300009414|Ga0114909_1193094 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009481|Ga0114932_10029204 | Not Available | 3691 | Open in IMG/M |
| 3300009481|Ga0114932_10177570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1301 | Open in IMG/M |
| 3300009481|Ga0114932_10206703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1193 | Open in IMG/M |
| 3300009481|Ga0114932_10714376 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009602|Ga0114900_1117060 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009604|Ga0114901_1132681 | Not Available | 759 | Open in IMG/M |
| 3300009604|Ga0114901_1196016 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009605|Ga0114906_1095248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1075 | Open in IMG/M |
| 3300009620|Ga0114912_1162046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 520 | Open in IMG/M |
| 3300009703|Ga0114933_10021945 | Not Available | 4972 | Open in IMG/M |
| 3300009703|Ga0114933_10092785 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
| 3300009703|Ga0114933_10770012 | Not Available | 615 | Open in IMG/M |
| 3300009703|Ga0114933_10862820 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300011013|Ga0114934_10349733 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300011013|Ga0114934_10430165 | Not Available | 586 | Open in IMG/M |
| 3300012920|Ga0160423_10204229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1376 | Open in IMG/M |
| 3300012952|Ga0163180_11201000 | Not Available | 619 | Open in IMG/M |
| 3300012953|Ga0163179_10421061 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300012953|Ga0163179_10450539 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300012953|Ga0163179_10857831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED227 | 782 | Open in IMG/M |
| 3300012953|Ga0163179_12118810 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 519 | Open in IMG/M |
| 3300017710|Ga0181403_1025225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1258 | Open in IMG/M |
| 3300017713|Ga0181391_1125272 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017720|Ga0181383_1037490 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1305 | Open in IMG/M |
| 3300017721|Ga0181373_1005240 | Not Available | 2489 | Open in IMG/M |
| 3300017729|Ga0181396_1070609 | Not Available | 702 | Open in IMG/M |
| 3300017740|Ga0181418_1053444 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1003 | Open in IMG/M |
| 3300017741|Ga0181421_1038049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1292 | Open in IMG/M |
| 3300017750|Ga0181405_1121307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 652 | Open in IMG/M |
| 3300017755|Ga0181411_1055064 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300017755|Ga0181411_1161273 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017756|Ga0181382_1041833 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300017758|Ga0181409_1070670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300017764|Ga0181385_1102019 | Not Available | 878 | Open in IMG/M |
| 3300017764|Ga0181385_1110475 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 841 | Open in IMG/M |
| 3300017764|Ga0181385_1185151 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300017769|Ga0187221_1118686 | Not Available | 798 | Open in IMG/M |
| 3300017770|Ga0187217_1257563 | Not Available | 568 | Open in IMG/M |
| 3300017771|Ga0181425_1217175 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017773|Ga0181386_1031112 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300020410|Ga0211699_10063664 | All Organisms → Viruses → environmental samples → uncultured virus | 1364 | Open in IMG/M |
| 3300020413|Ga0211516_10498062 | Not Available | 532 | Open in IMG/M |
| 3300020419|Ga0211512_10043877 | Not Available | 2168 | Open in IMG/M |
| 3300020436|Ga0211708_10104361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1111 | Open in IMG/M |
| 3300020452|Ga0211545_10543247 | Not Available | 522 | Open in IMG/M |
| 3300020454|Ga0211548_10488894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 603 | Open in IMG/M |
| 3300020454|Ga0211548_10576286 | Not Available | 550 | Open in IMG/M |
| 3300020454|Ga0211548_10588393 | Not Available | 544 | Open in IMG/M |
| 3300020463|Ga0211676_10210772 | Not Available | 1167 | Open in IMG/M |
| 3300020474|Ga0211547_10671165 | Not Available | 509 | Open in IMG/M |
| 3300022074|Ga0224906_1004382 | All Organisms → Viruses | 6063 | Open in IMG/M |
| 3300022074|Ga0224906_1033829 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300022074|Ga0224906_1053989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1279 | Open in IMG/M |
| 3300022074|Ga0224906_1117816 | Not Available | 771 | Open in IMG/M |
| 3300024344|Ga0209992_10104278 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1270 | Open in IMG/M |
| 3300024344|Ga0209992_10243326 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 750 | Open in IMG/M |
| 3300024344|Ga0209992_10398134 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025127|Ga0209348_1003491 | Not Available | 7102 | Open in IMG/M |
| 3300025127|Ga0209348_1010227 | All Organisms → cellular organisms → Bacteria | 3771 | Open in IMG/M |
| 3300025127|Ga0209348_1022331 | All Organisms → Viruses | 2349 | Open in IMG/M |
| 3300025127|Ga0209348_1059522 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300025127|Ga0209348_1070726 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1130 | Open in IMG/M |
| 3300025128|Ga0208919_1107009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 896 | Open in IMG/M |
| 3300025128|Ga0208919_1111320 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300025128|Ga0208919_1243114 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 525 | Open in IMG/M |
| 3300025132|Ga0209232_1022769 | Not Available | 2451 | Open in IMG/M |
| 3300025132|Ga0209232_1024085 | Not Available | 2373 | Open in IMG/M |
| 3300025132|Ga0209232_1068138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1257 | Open in IMG/M |
| 3300025132|Ga0209232_1074302 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300025132|Ga0209232_1095017 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300025132|Ga0209232_1145496 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300025132|Ga0209232_1174614 | Not Available | 671 | Open in IMG/M |
| 3300025132|Ga0209232_1175178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 670 | Open in IMG/M |
| 3300025132|Ga0209232_1194389 | Not Available | 623 | Open in IMG/M |
| 3300025251|Ga0208182_1049666 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300025267|Ga0208179_1051943 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025301|Ga0208450_1140528 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028022|Ga0256382_1003299 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
| 3300029319|Ga0183748_1037969 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1478 | Open in IMG/M |
| 3300029319|Ga0183748_1070675 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300029448|Ga0183755_1029436 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300029787|Ga0183757_1001611 | Not Available | 9507 | Open in IMG/M |
| 3300029787|Ga0183757_1041067 | Not Available | 872 | Open in IMG/M |
| 3300029787|Ga0183757_1065741 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 29.63% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 20.37% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.74% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 13.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 12.04% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 4.63% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.85% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_100397414 | 3300000947 | Macroalgal Surface | MTMFHGLGMFILGMFAIIIGGMIAWYIINKVMKNDGR* |
| BBAY94_101313292 | 3300000949 | Macroalgal Surface | MTMYHGLGMFILGMFAIIVGGMIAWYVINKVVKDDEEK* |
| GOS2241_10171392 | 3300001945 | Marine | MTMFHGLGMFILGMFAIIIGGIIAWYIINKVMEDDGR* |
| JGI25128J35275_10238094 | 3300002488 | Marine | MTFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDDENNSDN* |
| Ga0098038_10076928 | 3300006735 | Marine | MSFYHGLSMFFFSMGALIVGALITWYVINKVMEDDEKK* |
| Ga0098038_10876922 | 3300006735 | Marine | MSFYHGLGMFFLGMGAIIIGGIIAWYVINKVMEDDDT* |
| Ga0098038_11895673 | 3300006735 | Marine | MSFYHGLGMFIFGMSAFIIGGIITWYVINKVMEDNDT* |
| Ga0098037_10367395 | 3300006737 | Marine | MSFYDGLGMFFLGMGAIIVGGMIAWYVINKVMEDDEKK* |
| Ga0098037_10386365 | 3300006737 | Marine | MTMFHGLGMFILGMFAIIIGGVIAWYIINKVEKNDEEER* |
| Ga0098037_11612082 | 3300006737 | Marine | MSFYHGLGMFIFGMSAFIIGGIIAWYVINKVMEDDEVE* |
| Ga0098037_13009622 | 3300006737 | Marine | MSFYHGLGMFFLGMGAIIVGGMVAWYVINKVMEDDENNNN* |
| Ga0098036_10575202 | 3300006929 | Marine | MTMFHGLGMFILGMFAIIVGGMIAWYVINKVMEDDEKK* |
| Ga0098036_11326062 | 3300006929 | Marine | MSFYHGLGMFIFGMSAFIIGGIIAWYIINKVMEDDDT* |
| Ga0098036_12016942 | 3300006929 | Marine | MSFYYGLGMFFLGMGAIIVGGMIAWYIINKVMEDDEVE* |
| Ga0110931_11702852 | 3300007963 | Marine | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVTEDNDT* |
| Ga0114898_10092262 | 3300008216 | Deep Ocean | MSFYHGLSMFFLGMGVIIIGGMIAWYVINKVTEDDDT* |
| Ga0114898_10275134 | 3300008216 | Deep Ocean | MSFYHGLGMFIFGMSAIIIGGIIVWYVINKVMEDDERR* |
| Ga0114899_12099472 | 3300008217 | Deep Ocean | EFRMSFYHGLGMFFLGMGAIIIGGTIAWYVINKVMEDDEVE* |
| Ga0114910_12046151 | 3300008220 | Deep Ocean | MSFYHGLGMFFLGMSAIIIGGIIAWYVINKVMEDDDT* |
| Ga0114902_10889032 | 3300009413 | Deep Ocean | MSFYHGLGMLFLGMSAFIIGGIIAWYIINKVMEDDDT* |
| Ga0114902_10991051 | 3300009413 | Deep Ocean | FRMSFYHGLGMFIFGMSAFIIGGIIAWYVINKVTEDDEVEEII* |
| Ga0114909_11930942 | 3300009414 | Deep Ocean | MSFYHGLGMFFLGMGAIIIGGIIAWYVINKVMEDDEK* |
| Ga0114932_100292045 | 3300009481 | Deep Subsurface | MTMFHGLGMFMLGMFAIVIGAMIAWYVINKVMKEDEDKK* |
| Ga0114932_101775702 | 3300009481 | Deep Subsurface | MSFYHGLGMFFLGMGAIIVGGMIAWYIINKVMEDDEVE* |
| Ga0114932_102067033 | 3300009481 | Deep Subsurface | MSFYHGLGMFIFGMSAFVIGGIIAWYVINKVMEDDDT* |
| Ga0114932_107143762 | 3300009481 | Deep Subsurface | MTLFHGLGMFILGMFAIIIGGIIAWYIINKVMKDDGR* |
| Ga0114900_11170602 | 3300009602 | Deep Ocean | MSFYHGLGMFFLGMGAIIVGGIIAWYVINKVMEDDEVE* |
| Ga0114901_11326812 | 3300009604 | Deep Ocean | MSFYHGLGMFFLGMGAIIIGGIIVWYVINKVMEDDERR* |
| Ga0114901_11960162 | 3300009604 | Deep Ocean | MSFYHGLGMFCLGMGAIIIGGIIAWYIINKVTEDDEVE* |
| Ga0114906_10952481 | 3300009605 | Deep Ocean | MSFYHGLGMFFLGMSACIVGGIIAWYIINNVMEGDDS* |
| Ga0114912_11620462 | 3300009620 | Deep Ocean | MSFYHGLGMFFLGMSAFIIGGIIAWYIINKVMEDDDT* |
| Ga0114933_100219454 | 3300009703 | Deep Subsurface | MTMYHGLGMFILGMFAIIIGGVIAWYIINKVEKNDEEER* |
| Ga0114933_100927857 | 3300009703 | Deep Subsurface | MTMFHGLGMFMLGMFAIVIGAMIAWYVINKVMEEDEDKK* |
| Ga0114933_107700122 | 3300009703 | Deep Subsurface | YEFRMSFYHGLGMFFLGMSAFIIGGIIAWYVINKVMEDDDT* |
| Ga0114933_108628202 | 3300009703 | Deep Subsurface | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVTEDDEVE* |
| Ga0098043_11071422 | 3300010148 | Marine | MTMFHGLGMFFLGIGATLIGGLIVWWVINNFVIEDDEKKR* |
| Ga0114934_103497332 | 3300011013 | Deep Subsurface | MSFYHGLGMFFLGMGAIIVGGMIAWYIINKVMEDDDT* |
| Ga0114934_104301652 | 3300011013 | Deep Subsurface | MTMYHGLGMFMLGMFAIVIGAMFAWYVINKVMKEDEDKK* |
| Ga0160423_102042292 | 3300012920 | Surface Seawater | MSFYHGLGMFFFGMGAFIVGAIVAYYIINKVVGDDEEIR* |
| Ga0163180_112010001 | 3300012952 | Seawater | MTFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDDENNNDN* |
| Ga0163179_104210613 | 3300012953 | Seawater | MSFYHGLGMFILGMGAIIIGGIIAWYIINKVMEDDDT* |
| Ga0163179_104505394 | 3300012953 | Seawater | MSFYHGLGMFFLGMGAIIVGGMIAWYVISKVMEDDEKK* |
| Ga0163179_108578312 | 3300012953 | Seawater | MTFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDD |
| Ga0163179_121188102 | 3300012953 | Seawater | MTMYHGLGMFILGMFAIIIGGMIAWYVINKVVKDDEEK* |
| Ga0181403_10252251 | 3300017710 | Seawater | MSFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEEDDKE |
| Ga0181391_11252721 | 3300017713 | Seawater | MSFYHGLGMFFLGMGAIIVGGMVAWYVINKVMEDDENNNN |
| Ga0181383_10374904 | 3300017720 | Seawater | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVMEDDEVE |
| Ga0181373_10052401 | 3300017721 | Marine | FRMSFYHGLGMFFLGMGAIIIGGIIAWYIINKVTEDNDT |
| Ga0181396_10706092 | 3300017729 | Seawater | MSFYYGLGMFFFGMGAIIIGGIIAWYVINKVMEDDERR |
| Ga0181418_10534444 | 3300017740 | Seawater | MSFYHGLGMFFLGMGVIIIGGIIAWYVINKVMEDDERR |
| Ga0181421_10380492 | 3300017741 | Seawater | MSFYHGLGMFFLGMSAFVIGGIIAWYVINKVMEDDEVE |
| Ga0181405_11213072 | 3300017750 | Seawater | MSFYHGLGMFFLGMGAIIIGGIIAWYVINKFMENDEVE |
| Ga0181411_10550645 | 3300017755 | Seawater | MSFYHGLGMFFLGMGAIIVGALITWYVINKVMEDDEKK |
| Ga0181411_11612732 | 3300017755 | Seawater | MSFYHGLGMFIFGMSAFVIGGIIAWYVINKVMEDDEVE |
| Ga0181382_10418336 | 3300017756 | Seawater | MSFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDDERR |
| Ga0181409_10706703 | 3300017758 | Seawater | MSFYHGLGMFFLGMGAIIVGGMIAWYIINKVMEDDEKK |
| Ga0181385_11020192 | 3300017764 | Seawater | MSFYYGLGMFFFGMGAIIIGGIIAWYVINKVMEDDDT |
| Ga0181385_11104754 | 3300017764 | Seawater | MTMYHGLGMFILGMFAIIVGGMIAWYIINEVMKDDEEK |
| Ga0181385_11851512 | 3300017764 | Seawater | MTMFHGLGMFILGMFAIIIGGVIAWYIINKVEKNNEEER |
| Ga0187221_11186862 | 3300017769 | Seawater | SFYHGLGMFFLGMGVIIIGGIIAWYVINKVMEDDEVE |
| Ga0187217_12575632 | 3300017770 | Seawater | GGYEFRMSFYHGLGMFFLGMGAIIVGGIIAWYVINKVMEDDERR |
| Ga0181425_12171752 | 3300017771 | Seawater | MSFYYGLGMFFFGMGAIIIGGIIAWYVINKYIDNDDI |
| Ga0181386_10311124 | 3300017773 | Seawater | MTMFHGLGMFILGMFAIIIGGVIAWYIINKVVKDDEEK |
| Ga0211699_100636641 | 3300020410 | Marine | MTFYHGLGMFFLGMGAIIIGAFIAYFIINEVMKDDEEK |
| Ga0211516_104980621 | 3300020413 | Marine | MSFYHGLGMFFLGMGAIIIGGIIAWYVINKVMEDDEVE |
| Ga0211512_100438771 | 3300020419 | Marine | MTFYHGLGMFFLGMGAIIVGGIIAWYVINKVMEDDENNSDN |
| Ga0211708_101043613 | 3300020436 | Marine | MTMYHGLGMFILGMFAIIIGGMTAWYIINKVMEEKKEKTRWDDLE |
| Ga0211545_105432472 | 3300020452 | Marine | MTFYHGLGMFFLGMGAIIVGGMIAWYVINKVTEDDDT |
| Ga0211548_104888942 | 3300020454 | Marine | MTMFHGLGMFILGMFAIIIGGVIAWYIINEVEKNDEEER |
| Ga0211548_105762861 | 3300020454 | Marine | GGYEFRMSFYHGLGMFILGMGAIIIGGIIAWYIINKVMEDDDT |
| Ga0211548_105883932 | 3300020454 | Marine | MTFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDDENNNDN |
| Ga0211676_102107723 | 3300020463 | Marine | MTFYHGLGMFFLGMGAIIVGGMIAWYIINKVMEDDENNSDN |
| Ga0211547_106711652 | 3300020474 | Marine | MYMIGVQFRMTMFHGLGMFILGMFAIIIGGMIAWYVINKVMKDDEEK |
| Ga0224906_100438217 | 3300022074 | Seawater | MTMYHGLGMFILGMFAIIIGGVIAWYIINKVGENDEKK |
| Ga0224906_10338292 | 3300022074 | Seawater | MSFYDGLGMFFLGMGAIIVGALITWYVINKVMEDDEKK |
| Ga0224906_10539892 | 3300022074 | Seawater | MSFYHGLGMFFLGMGVIIIGGIIAWYVINKVMEDNEVE |
| Ga0224906_11178162 | 3300022074 | Seawater | MSFYHGLGMFFLGMGVIIIGGIIAWYVINKVMEDDEVE |
| Ga0209992_101042782 | 3300024344 | Deep Subsurface | MTMYHGLGMFILGMFAIIIGGVIAWYIINKVEKNDEEER |
| Ga0209992_102433262 | 3300024344 | Deep Subsurface | MSFYHGLGMFFLGMGAIIIGGIIAWYVINKVMEDDDT |
| Ga0209992_103981342 | 3300024344 | Deep Subsurface | MTLFHGLGMFILGMFAIIIGGIIAWYIINKVMKDDGR |
| Ga0209348_10034912 | 3300025127 | Marine | MTMYHGLGMFILGMFAIIIGGVIAWYIINKVEKNNEEER |
| Ga0209348_10102274 | 3300025127 | Marine | MYMIGVQFRMTMYHGLGMFILGMFAIIIGGVIAWYIINKVEKNNEEE |
| Ga0209348_10223315 | 3300025127 | Marine | MTMFHGLGMFILGMFAIIVGGMIAWYVINKVMKEYEKK |
| Ga0209348_10595223 | 3300025127 | Marine | MSFYDGLGMFFFSMGALIVGALITWYVINKVMEDDEKK |
| Ga0209348_10707262 | 3300025127 | Marine | MTMFHGLGMFILGMFAIIIGGVIAWYIINKVEKNDKK |
| Ga0208919_11070092 | 3300025128 | Marine | MTMFHGLGMFILGMFAIIVGGMIAWYVINKVEKNDGR |
| Ga0208919_11113202 | 3300025128 | Marine | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVTEDNDT |
| Ga0208919_12431142 | 3300025128 | Marine | MSFYYGLGMFFLGMGAIIVGGMIAWYIINKVMEDDEVE |
| Ga0209232_10227696 | 3300025132 | Marine | MTFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDDENNSDN |
| Ga0209232_10240852 | 3300025132 | Marine | MSFYDGLGMFFLGMGAIIVGALIVWYVINNYVDNDEDNNN |
| Ga0209232_10681383 | 3300025132 | Marine | MTMYHGLGMFILGMFAIIIGGIITWYIINKVEKNDEEER |
| Ga0209232_10743024 | 3300025132 | Marine | MTMYHGLGMFILGMFAIIIGGMIAWYIINKVMKDDEEK |
| Ga0209232_10950173 | 3300025132 | Marine | MSFYHGLGMFFLGMGAIIVGGMIAWYVINKVMEDDEKK |
| Ga0209232_11454963 | 3300025132 | Marine | MYHGLGMFILGMFAIIIGGVIAWYIINKVGENDEKK |
| Ga0209232_11746141 | 3300025132 | Marine | MFHGLGMFILGMFAIIIGGVIAWYIINKVEKNDKK |
| Ga0209232_11751782 | 3300025132 | Marine | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVMEDD |
| Ga0209232_11943891 | 3300025132 | Marine | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVMEDDDT |
| Ga0208182_10496664 | 3300025251 | Deep Ocean | MSFYHGLGMFFLGMGAIIIGGIIAWYIINKVMEDDEK |
| Ga0208179_10519432 | 3300025267 | Deep Ocean | MSFYHGLSMFFLGMGVIIIGGMIAWYVINKVTEDDDT |
| Ga0208450_11405281 | 3300025301 | Deep Ocean | MSFYHGLGMFFLGMGAIIIGGIIVWYVINKVMEDDERR |
| Ga0256382_10032996 | 3300028022 | Seawater | MTMFHGLGMFMLGMFAIVIGAMIAWYVINKVMKEDEDKK |
| Ga0183683_10119553 | 3300029309 | Marine | MTMFHGLGMFFLGIGATLIGGLIVWWVINNFVIEDDEKKR |
| Ga0183748_10379692 | 3300029319 | Marine | MTFYHGLGMFILGMFAIIIGGMIAWYIINKIGGKNETKS |
| Ga0183748_10706752 | 3300029319 | Marine | MSFYHGLGMFILGMSAIIIGGIITWYIINKVMDKNEME |
| Ga0183755_10294363 | 3300029448 | Marine | MTFHYGLGMFFLGMGVIIVGGLIAFYVINKFIDNDKK |
| Ga0183757_100161126 | 3300029787 | Marine | MTMFHGLGMFILGMFAIIIGGMIAWYIINKVEKNDKEER |
| Ga0183757_10410673 | 3300029787 | Marine | MSFYHGLGMFFLGMGTIIIGGMIAWYVINKVMEDDERR |
| Ga0183757_10657412 | 3300029787 | Marine | MSFYHGLGMFIFGMSAFIIGGIIAWYVINKVTEDDEVE |
| ⦗Top⦘ |