


| Basic Information | |
|---|---|
| Family ID | F090186 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 47 residues |
| Representative Sequence | WGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.15 % |
| % of genes from short scaffolds (< 2000 bps) | 96.30 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.444 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.926 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.222 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.67% Coil/Unstructured: 77.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 91.67 |
| PF08240 | ADH_N | 0.93 |
| PF01152 | Bac_globin | 0.93 |
| PF12773 | DZR | 0.93 |
| PF13304 | AAA_21 | 0.93 |
| PF00296 | Bac_luciferase | 0.93 |
| PF01979 | Amidohydro_1 | 0.93 |
| PF07596 | SBP_bac_10 | 0.93 |
| PF03167 | UDG | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG2165 | Type II secretory pathway, pseudopilin PulG | Cell motility [N] | 1.85 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.93 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.67 % |
| Unclassified | root | N/A | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_10533794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300002562|JGI25382J37095_10175789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300002908|JGI25382J43887_10339186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 640 | Open in IMG/M |
| 3300002908|JGI25382J43887_10424444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300004157|Ga0062590_101059884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 777 | Open in IMG/M |
| 3300004480|Ga0062592_100073116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1993 | Open in IMG/M |
| 3300004633|Ga0066395_10574657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 658 | Open in IMG/M |
| 3300005174|Ga0066680_10052963 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300005178|Ga0066688_10956345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300005295|Ga0065707_11156996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300005332|Ga0066388_103059611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 855 | Open in IMG/M |
| 3300005406|Ga0070703_10433932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 579 | Open in IMG/M |
| 3300005447|Ga0066689_10702289 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005467|Ga0070706_100520248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1107 | Open in IMG/M |
| 3300005467|Ga0070706_101265638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300005468|Ga0070707_100556254 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300005540|Ga0066697_10181960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1248 | Open in IMG/M |
| 3300005540|Ga0066697_10477848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 712 | Open in IMG/M |
| 3300005557|Ga0066704_10552231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 750 | Open in IMG/M |
| 3300005568|Ga0066703_10275564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1019 | Open in IMG/M |
| 3300005598|Ga0066706_11173580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300005713|Ga0066905_101229539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 671 | Open in IMG/M |
| 3300005713|Ga0066905_101517836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300005713|Ga0066905_101527769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
| 3300005719|Ga0068861_102395345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300005843|Ga0068860_100101247 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300006791|Ga0066653_10655376 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006794|Ga0066658_10644325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300006796|Ga0066665_10888318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 692 | Open in IMG/M |
| 3300006797|Ga0066659_10406797 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300006969|Ga0075419_10416378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 923 | Open in IMG/M |
| 3300007076|Ga0075435_101344740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300007255|Ga0099791_10359812 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300009012|Ga0066710_102599503 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009038|Ga0099829_10557488 | Not Available | 952 | Open in IMG/M |
| 3300009038|Ga0099829_10773902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 797 | Open in IMG/M |
| 3300009090|Ga0099827_10269341 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300009147|Ga0114129_12190753 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009156|Ga0111538_12875013 | Not Available | 602 | Open in IMG/M |
| 3300009162|Ga0075423_11580073 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009678|Ga0105252_10169890 | Not Available | 920 | Open in IMG/M |
| 3300009792|Ga0126374_11705737 | Not Available | 524 | Open in IMG/M |
| 3300009822|Ga0105066_1125799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300010043|Ga0126380_10260480 | Not Available | 1207 | Open in IMG/M |
| 3300010046|Ga0126384_10883390 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300010047|Ga0126382_10151719 | Not Available | 1587 | Open in IMG/M |
| 3300010303|Ga0134082_10119794 | Not Available | 1051 | Open in IMG/M |
| 3300010304|Ga0134088_10156674 | Not Available | 1084 | Open in IMG/M |
| 3300010333|Ga0134080_10214115 | Not Available | 839 | Open in IMG/M |
| 3300010360|Ga0126372_11121409 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300010360|Ga0126372_11706991 | Not Available | 671 | Open in IMG/M |
| 3300010361|Ga0126378_10434895 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300010362|Ga0126377_10706103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1061 | Open in IMG/M |
| 3300010362|Ga0126377_11348787 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300010362|Ga0126377_11367248 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010398|Ga0126383_10606199 | Not Available | 1167 | Open in IMG/M |
| 3300011271|Ga0137393_11066216 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012198|Ga0137364_10160929 | Not Available | 1629 | Open in IMG/M |
| 3300012202|Ga0137363_10590984 | Not Available | 937 | Open in IMG/M |
| 3300012203|Ga0137399_10283427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300012204|Ga0137374_10301029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300012206|Ga0137380_11764731 | Not Available | 502 | Open in IMG/M |
| 3300012351|Ga0137386_10935097 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012360|Ga0137375_10270176 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300012685|Ga0137397_10314002 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300012929|Ga0137404_10961695 | Not Available | 780 | Open in IMG/M |
| 3300012929|Ga0137404_10996462 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012929|Ga0137404_11551990 | Not Available | 613 | Open in IMG/M |
| 3300012948|Ga0126375_10656467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 810 | Open in IMG/M |
| 3300014968|Ga0157379_11764172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 607 | Open in IMG/M |
| 3300015200|Ga0173480_10059341 | Not Available | 1746 | Open in IMG/M |
| 3300015357|Ga0134072_10386298 | Not Available | 548 | Open in IMG/M |
| 3300018053|Ga0184626_10012844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3304 | Open in IMG/M |
| 3300018077|Ga0184633_10271107 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300018081|Ga0184625_10343754 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300018422|Ga0190265_12830060 | Not Available | 580 | Open in IMG/M |
| 3300018468|Ga0066662_11234212 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300019883|Ga0193725_1070056 | Not Available | 866 | Open in IMG/M |
| 3300020199|Ga0179592_10420672 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025910|Ga0207684_10545018 | Not Available | 993 | Open in IMG/M |
| 3300025911|Ga0207654_11070421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300025922|Ga0207646_10143840 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300026298|Ga0209236_1317372 | Not Available | 504 | Open in IMG/M |
| 3300026318|Ga0209471_1180352 | Not Available | 833 | Open in IMG/M |
| 3300026322|Ga0209687_1276498 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026332|Ga0209803_1303089 | Not Available | 548 | Open in IMG/M |
| 3300026446|Ga0257178_1005056 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300026469|Ga0257169_1056243 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300026537|Ga0209157_1157211 | Not Available | 1013 | Open in IMG/M |
| 3300026537|Ga0209157_1357167 | Not Available | 526 | Open in IMG/M |
| 3300026557|Ga0179587_10357573 | Not Available | 948 | Open in IMG/M |
| 3300027846|Ga0209180_10241264 | Not Available | 1040 | Open in IMG/M |
| 3300027862|Ga0209701_10213300 | Not Available | 1145 | Open in IMG/M |
| 3300027875|Ga0209283_10695840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 635 | Open in IMG/M |
| 3300028814|Ga0307302_10094012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1428 | Open in IMG/M |
| 3300030336|Ga0247826_11720181 | Not Available | 512 | Open in IMG/M |
| 3300031720|Ga0307469_12081972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300031771|Ga0318546_10254525 | Not Available | 1209 | Open in IMG/M |
| 3300031820|Ga0307473_10437659 | Not Available | 867 | Open in IMG/M |
| 3300031820|Ga0307473_10756761 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031893|Ga0318536_10497057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300032044|Ga0318558_10269012 | Not Available | 840 | Open in IMG/M |
| 3300032066|Ga0318514_10167790 | Not Available | 1143 | Open in IMG/M |
| 3300033233|Ga0334722_10852569 | Not Available | 644 | Open in IMG/M |
| 3300033433|Ga0326726_11467813 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300034090|Ga0326723_0277517 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300034659|Ga0314780_224605 | Not Available | 501 | Open in IMG/M |
| 3300034660|Ga0314781_101568 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_105337941 | 3300000891 | Soil | KEWDTWGITPPFTYTNEDHRPTNRARMVVIKDGKVNFVREVSVERDMKWIGK* |
| JGI25382J37095_101757891 | 3300002562 | Grasslands Soil | PPFTYTSEDHRPTNRARLVMVKAGKIVPVREVSVDRDMKWIGK* |
| JGI25382J43887_103391862 | 3300002908 | Grasslands Soil | ESLKEWDTWGITPPFTYTSEDHRPTNRARLVVIKNGKVVPLHEVTVERDMKWIGK* |
| JGI25382J43887_104244441 | 3300002908 | Grasslands Soil | ITPPFTYTNEDHRPTVRARLVVIKDGKVVPVREVSVERDMKWIGK* |
| Ga0062590_1010598841 | 3300004157 | Soil | FDTWGITPPFTYTNEDHRPTNRARFVMIQNAKIVPMREVSVDRSMKWIGK* |
| Ga0062592_1000731161 | 3300004480 | Soil | ESMKDFDTWGITPPFTYTNEDHRPTNRGRLVQIKGGKVVQLKEVSVDRDMKWIGK* |
| Ga0066395_105746572 | 3300004633 | Tropical Forest Soil | FKDFDPWGLAPPFSYTNEDHRPTNRAKLVLIKGGKVLPLREVTVDRDMKWVGK* |
| Ga0066680_100529635 | 3300005174 | Soil | TWGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0066688_109563451 | 3300005178 | Soil | WGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0065707_111569961 | 3300005295 | Switchgrass Rhizosphere | TWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK* |
| Ga0066388_1030596111 | 3300005332 | Tropical Forest Soil | PPFTYTNEDHRPTNRARFVLIKDGKVTFVREVSVERDMKWIGK* |
| Ga0070703_104339322 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | WGITPPFTYTNEDHRPTNRARLVVIKDGKVVPMKEVSVERDMKWIGK* |
| Ga0066689_107022892 | 3300005447 | Soil | TPPFTYTSEDHRPTNRARLVMIKDGKVVPLKEVSVERDMKWIGK* |
| Ga0070706_1005202481 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ITPPFTYTNEDHRPTNRARLVMVKDGKIAQLREVSVERDMKWIGK* |
| Ga0070706_1012656381 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FTYTNEDHRPTNRGRLVQIKGGKIVQLKEVSVERDMKWIGK* |
| Ga0070707_1005562541 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDRKDFDTWGLTPPFTYTNEDHRPTNRGRLVQIKVGKIVQLKEVSVERDMKWIGK* |
| Ga0066697_101819601 | 3300005540 | Soil | YTNEDHRPTNRARLVVVKGGKVVPVREVSVERDMKWIGR* |
| Ga0066697_104778482 | 3300005540 | Soil | WGITPPFTYTNEDHRPTNRARLVVIKDGKVVPIREVSVERDMKWIGK* |
| Ga0066704_105522312 | 3300005557 | Soil | TNEDHRPTNRARLVMVKGGKIVQLKEVSVERDMKWIGK* |
| Ga0066703_102755642 | 3300005568 | Soil | TPPFTYTNEDHRPTTRARLVVIKDGKVVPLREVSVERDMKWIGR* |
| Ga0066706_111735802 | 3300005598 | Soil | EDHRPTNRARLVMIKDGKIVQMREVSVERDMKWIGK* |
| Ga0066905_1012295392 | 3300005713 | Tropical Forest Soil | ESIKRALESLREFDTWGITPPFTYTNEDHRPTNRARLVIVKGGKIALVREVTVDRDMKWVGK* |
| Ga0066905_1015178361 | 3300005713 | Tropical Forest Soil | KRALENLKEFDTWGLTPPFTYTSEDHRPTNRARLVMVKDGKIVPVREVLVDRDMKWIGK* |
| Ga0066905_1015277692 | 3300005713 | Tropical Forest Soil | VKNALESLKEWDTWGITPPFTYTNEDHRPTNRARFVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0068861_1023953451 | 3300005719 | Switchgrass Rhizosphere | ESLKEWDTWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK* |
| Ga0068860_1001012471 | 3300005843 | Switchgrass Rhizosphere | NEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0066653_106553761 | 3300006791 | Soil | HRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0066658_106443252 | 3300006794 | Soil | KKALESLREWDTWGITPPFTYTNEDHRPTNRARLVVVKGGKVVPVREVSVERDMKWIGR* |
| Ga0066665_108883182 | 3300006796 | Soil | TYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0066659_104067972 | 3300006797 | Soil | WGITPPFTYTSEDHRPTNRARLVMIKDGKVVPLKEVSVERDMKWIGK* |
| Ga0075419_104163781 | 3300006969 | Populus Rhizosphere | WGITPPFTYTNEDHRPTNRARLVVIKDGKVVPRKEVSVERDMKWIGK* |
| Ga0075435_1013447401 | 3300007076 | Populus Rhizosphere | TPPFTYTNEDHRPTNRARFVMIQNAKIVPMREVSVDRSMKWIGK* |
| Ga0099791_103598121 | 3300007255 | Vadose Zone Soil | TYTSEDHRPTTRARFVQIKGGKVVPMREVTVERDMKWVGK* |
| Ga0066710_1025995031 | 3300009012 | Grasslands Soil | EDHRPTNRARLVMIKDGKIVQMREVSVERDMKWIGK |
| Ga0099829_105574881 | 3300009038 | Vadose Zone Soil | YTSEDHRPTNRARLVMIKDGKIVQMREVSVERDMKWIGK* |
| Ga0099829_107739021 | 3300009038 | Vadose Zone Soil | KDFDTWGLTPPFTYTTEDHRPTNRARLVMIKGGKIVQMREVSVDRDMKWIGK* |
| Ga0099827_102693411 | 3300009090 | Vadose Zone Soil | SEDHRPTMRARLVLVKDGKLVPLREVTVERDMKWIGK* |
| Ga0114129_121907531 | 3300009147 | Populus Rhizosphere | HRPTVRARLVLIKGGKIVPIREVSVTRDMAWIGK* |
| Ga0111538_128750131 | 3300009156 | Populus Rhizosphere | LKEWDTWGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0075423_115800732 | 3300009162 | Populus Rhizosphere | PFTYTNEDHRPTNRARLVVIKDGKVVPMKEVSVERDMKWIGK* |
| Ga0105252_101698902 | 3300009678 | Soil | SEDHRPTNRARLVMVKDGKIVQMREVSVDRDMKWIGK* |
| Ga0126374_117057372 | 3300009792 | Tropical Forest Soil | PFSYTSEDHRPTNRARLVLIKDGKITQLREVSVDRDMKWIGK* |
| Ga0105066_11257991 | 3300009822 | Groundwater Sand | KKALESLKEFDTWGLTPPFTYTTEDHRPTNRARLVLVKDGKIVPVREVSVDRDMKWIGK* |
| Ga0126380_102604802 | 3300010043 | Tropical Forest Soil | EFDTWGITPPFTYTTEDHRPTNRARLVMIKDGKLVQLREVSVDRDMKWIGK* |
| Ga0126384_108833901 | 3300010046 | Tropical Forest Soil | TWGITPPFTYTSEDHRPTNRARFVAIQGGKIVQLREVSVDRDMKWIGK* |
| Ga0126382_101517191 | 3300010047 | Tropical Forest Soil | SEDHRPTNRARLVMVKGGKIVPVREVSVDRDMKWLGK* |
| Ga0134082_101197941 | 3300010303 | Grasslands Soil | TGGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGR* |
| Ga0134088_101566742 | 3300010304 | Grasslands Soil | FTYTSEDHRPTNRARLVMIKDGKIVQMREVSVERDMKWIGK* |
| Ga0134080_102141151 | 3300010333 | Grasslands Soil | HRPTNRARLVLIKDGKITQLREVSVDRDMKWIGK* |
| Ga0126372_111214091 | 3300010360 | Tropical Forest Soil | FKDFDPWGLAPGFTYTSEDHRPTVRAKLVLIKGGKTTALREVTVDRDMKWVGK* |
| Ga0126372_117069911 | 3300010360 | Tropical Forest Soil | EDHRPTNRARLVLIKDGKITQLREVSVDRDMKWIGK* |
| Ga0126378_104348951 | 3300010361 | Tropical Forest Soil | DHRPTNRARFVLIKDGKVTFVREVSVERDMKWIGK* |
| Ga0126377_107061031 | 3300010362 | Tropical Forest Soil | TNEDHRPTNRARLVVIKDSKVVPVKEVSVEGDMK* |
| Ga0126377_113487872 | 3300010362 | Tropical Forest Soil | SFKEFDTWGITPPFTYTTEDHRPTNRARLVMIKDGKIVQLREVSVDRDMKWIGK* |
| Ga0126377_113672481 | 3300010362 | Tropical Forest Soil | WGITPPFTYTTEDHRPTNRARLVMVKDGKIVPVREVSVDRDMKWIGK* |
| Ga0126383_106061991 | 3300010398 | Tropical Forest Soil | LESLNEFDTWGITPPFTYTSEDHRPTNRARLVMVKGGKIVPVLEVSVDRDMKWLGK* |
| Ga0137393_110662161 | 3300011271 | Vadose Zone Soil | KEFDTWGLTPPFTYTSEDHRPTNRARLVQIKGGKVVPMHEVTVARDMKWIGK* |
| Ga0137364_101609293 | 3300012198 | Vadose Zone Soil | SEDHRPTNRARLVMVKDGKIVPVREVSVDRDMKWIGK* |
| Ga0137363_105909841 | 3300012202 | Vadose Zone Soil | SLSEFDTWGITPPFTYTNEDHRPTNRARLVMIQSGKIVPMREVSVDRSMKWIGK* |
| Ga0137399_102834271 | 3300012203 | Vadose Zone Soil | WDTWGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0137374_103010293 | 3300012204 | Vadose Zone Soil | PPFTYTSEDHRPTNRARLVMIKDGKIVQMREVSAKRDMKWIGK* |
| Ga0137380_117647311 | 3300012206 | Vadose Zone Soil | KDFDTWGITPPFTYTNEDHRPTNRARLVIVKGGKIVQMKEVSVERDMKWIGK* |
| Ga0137386_109350972 | 3300012351 | Vadose Zone Soil | EDHRPTNRARLVMVKDGKIVQLREVSVERDMKWIGK* |
| Ga0137375_102701763 | 3300012360 | Vadose Zone Soil | DTWGLTPPFTYTSEDHRPTNRARLVMIKDGKIVQMREVSVERDMKWIGK* |
| Ga0137397_103140021 | 3300012685 | Vadose Zone Soil | TWGITPPFTYTNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK* |
| Ga0137404_109616952 | 3300012929 | Vadose Zone Soil | FTYTNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK* |
| Ga0137404_109964621 | 3300012929 | Vadose Zone Soil | TSEDHRPTNRARLVMIKDGKVVPIKEVSVEGDTKRNGK* |
| Ga0137404_115519901 | 3300012929 | Vadose Zone Soil | TWGITPPFTYTSEDHRPTNRARLVLIKGGKIVPVREVSVDRDMKWVGK* |
| Ga0126375_106564671 | 3300012948 | Tropical Forest Soil | ALESLKEWDTWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK* |
| Ga0157379_117641721 | 3300014968 | Switchgrass Rhizosphere | VKTALESLKEWDTWGITPPFTYTNEDHRPTNRARMVVIKDGKVNFVREVSVERDMKWIGK |
| Ga0173480_100593411 | 3300015200 | Soil | SMKDFDTWGITPPFTYTNEDHRPTNRGRLVQIKGGKVVQLKEVSVDRDMKWIGK* |
| Ga0134072_103862981 | 3300015357 | Grasslands Soil | PPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK* |
| Ga0184626_100128441 | 3300018053 | Groundwater Sediment | FKEFDTWGLTPPFTYTSEDHRPTNRARLVQVKGGKIVQIREVSVDRDMKWIGK |
| Ga0184633_102711072 | 3300018077 | Groundwater Sediment | TPPFTYTNEDHRPTNRARLVQVKGGKIVQVREVSVERDMKWIGK |
| Ga0184625_103437542 | 3300018081 | Groundwater Sediment | FDTWGLTPPFTYTSEDHRPTNRARLVQVKGGKIVQMREVSVDRDMKWIGK |
| Ga0190265_128300601 | 3300018422 | Soil | EDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK |
| Ga0066662_112342121 | 3300018468 | Grasslands Soil | ALETLREWDTWGITPPFTYTSEDHRPTNRARLVVIKNGKVVPLHEVTVERDMKWIGK |
| Ga0193725_10700562 | 3300019883 | Soil | TFTNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK |
| Ga0179592_104206722 | 3300020199 | Vadose Zone Soil | TWGITPPFSYTNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK |
| Ga0207684_105450182 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDRKDFDTWGLTPPFTYTNEDHRPTNRGRLVQIKGGKIVQLKEVSVERDMKWIGK |
| Ga0207654_110704212 | 3300025911 | Corn Rhizosphere | NALESLKEWDTWGITPPFTYTNEDHRPTNRARLVLIKDGKVSFVREVSVERDMKWIGK |
| Ga0207646_101438401 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPPFTYTNEDHRPTNRARLVMVKDGKIAQLREVSVERDMKCIGK |
| Ga0209236_13173722 | 3300026298 | Grasslands Soil | NEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK |
| Ga0209471_11803521 | 3300026318 | Soil | DHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK |
| Ga0209687_12764981 | 3300026322 | Soil | EWDTWGITPPFTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK |
| Ga0209803_13030891 | 3300026332 | Soil | TPPFTYTSEDHRPTNRARLVMIKDGKVVPLKEVSVERDMKWIGK |
| Ga0257178_10050561 | 3300026446 | Soil | KDFDTWGITPPFSYTNEDHRPTNRARLVMVKGGKIVQMKEVSIERDMKWIGK |
| Ga0257169_10562432 | 3300026469 | Soil | DTWGITPPFSYTNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK |
| Ga0209157_11572112 | 3300026537 | Soil | FTYTNEDHRPTNRARLVVIKDGKVVPVKEVSVERDMKWIGK |
| Ga0209157_13571672 | 3300026537 | Soil | PPFTYTSEDHRPTNRARLVMIKDGKIVQMREVSVERDMKWIGK |
| Ga0179587_103575731 | 3300026557 | Vadose Zone Soil | TNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK |
| Ga0209180_102412642 | 3300027846 | Vadose Zone Soil | KDFDTWGLTPPFTYTTEDHRPTNRARLVMIKGGKIVQMREVSVDRDMKWIGK |
| Ga0209701_102133003 | 3300027862 | Vadose Zone Soil | DTWGLTPPFTYTSEDHRPTNRARLVQVKDGKIIQVREVSVERDMKWIGK |
| Ga0209283_106958401 | 3300027875 | Vadose Zone Soil | SIKTALESLKEFDTWGLTPPFTYTNEDHRPTNRARLVMIQSGKIVQMHEVSVDRSMKWIG |
| Ga0307302_100940121 | 3300028814 | Soil | VVAVSLSLKEFDTWGITPPFTYTNEDHRPTNRARLVMIQGSKIVPMREVSVDRSMKWIGK |
| Ga0247826_117201812 | 3300030336 | Soil | YTNEDQRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0307469_120819722 | 3300031720 | Hardwood Forest Soil | ALETLREWDTWGITPPFTYTNEDHRPTNRARLVVIKEGKVVPVKEVSVERDMKWIGK |
| Ga0318546_102545253 | 3300031771 | Soil | WDTWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0307473_104376592 | 3300031820 | Hardwood Forest Soil | TWGITPPFTYTNEDHRPTNRARLVMVKGGKIVQMKEVSVERDMKWIGK |
| Ga0307473_107567612 | 3300031820 | Hardwood Forest Soil | EDHRPTNRARLVMIKGGQIVQLKEVSVARDMKWIGK |
| Ga0318536_104970572 | 3300031893 | Soil | TGESVKNALESLKEWDTWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0318558_102690122 | 3300032044 | Soil | EWDTWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0318514_101677903 | 3300032066 | Soil | TWGITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0334722_108525691 | 3300033233 | Sediment | DFDTWGITPPFTYTNEDHRPTNRARLVMVKDGKIVQMREVSVERDMKWIGK |
| Ga0326726_114678131 | 3300033433 | Peat Soil | PPFTYTNEDHRPTNRARLVMIQGSKIVPMREVSVDRSMKWIGK |
| Ga0326723_0277517_1_132 | 3300034090 | Peat Soil | PPFTFTSEDHRPTNRARLVEIKGGKIVQLREVSVDRDMKWIGK |
| Ga0314780_224605_359_499 | 3300034659 | Soil | GITPPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| Ga0314781_101568_2_133 | 3300034660 | Soil | PPFTYTNEDHRPTNRARLVLIKDGKVTFVREVSVERDMKWIGK |
| ⦗Top⦘ |