


| Basic Information | |
|---|---|
| Family ID | F090181 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNQHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 27.78 % |
| % of genes from short scaffolds (< 2000 bps) | 70.37 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.926 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF06778 | Chlor_dismutase | 44.44 |
| PF01040 | UbiA | 18.52 |
| PF00510 | COX3 | 6.48 |
| PF01208 | URO-D | 5.56 |
| PF00115 | COX1 | 1.85 |
| PF03626 | COX4_pro | 1.85 |
| PF13806 | Rieske_2 | 0.93 |
| PF00762 | Ferrochelatase | 0.93 |
| PF13458 | Peripla_BP_6 | 0.93 |
| PF13442 | Cytochrome_CBB3 | 0.93 |
| PF13450 | NAD_binding_8 | 0.93 |
| PF02780 | Transketolase_C | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 44.44 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 6.48 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 5.56 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 1.85 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10001242 | All Organisms → cellular organisms → Bacteria | 7974 | Open in IMG/M |
| 3300002558|JGI25385J37094_10007652 | All Organisms → cellular organisms → Bacteria | 3832 | Open in IMG/M |
| 3300002562|JGI25382J37095_10166481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
| 3300002886|JGI25612J43240_1020972 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300002908|JGI25382J43887_10045570 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300002908|JGI25382J43887_10387223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 591 | Open in IMG/M |
| 3300005166|Ga0066674_10036934 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300005166|Ga0066674_10138759 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005172|Ga0066683_10321602 | Not Available | 961 | Open in IMG/M |
| 3300005176|Ga0066679_10076036 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300005180|Ga0066685_10172422 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005181|Ga0066678_10029401 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300005186|Ga0066676_10943175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300005187|Ga0066675_11215863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300005445|Ga0070708_100070545 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
| 3300005447|Ga0066689_10430767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300005471|Ga0070698_100016221 | All Organisms → cellular organisms → Bacteria | 7864 | Open in IMG/M |
| 3300005555|Ga0066692_10557081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 724 | Open in IMG/M |
| 3300005556|Ga0066707_10006693 | All Organisms → cellular organisms → Bacteria | 5330 | Open in IMG/M |
| 3300005561|Ga0066699_11248421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300005569|Ga0066705_10051210 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_2_62_10 | 2320 | Open in IMG/M |
| 3300005575|Ga0066702_10004353 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 5535 | Open in IMG/M |
| 3300005598|Ga0066706_10397558 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300006031|Ga0066651_10017863 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
| 3300006031|Ga0066651_10119330 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300006032|Ga0066696_10672769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
| 3300006791|Ga0066653_10752491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300006852|Ga0075433_10068518 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300006854|Ga0075425_101715398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
| 3300006903|Ga0075426_10473898 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300007076|Ga0075435_100066527 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300007076|Ga0075435_100942071 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300007255|Ga0099791_10267934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 812 | Open in IMG/M |
| 3300007265|Ga0099794_10093469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1495 | Open in IMG/M |
| 3300007265|Ga0099794_10249766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 915 | Open in IMG/M |
| 3300009038|Ga0099829_10002083 | All Organisms → cellular organisms → Bacteria | 11354 | Open in IMG/M |
| 3300009038|Ga0099829_10830463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 767 | Open in IMG/M |
| 3300009089|Ga0099828_10125007 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300009090|Ga0099827_10034502 | All Organisms → cellular organisms → Bacteria | 3686 | Open in IMG/M |
| 3300009090|Ga0099827_10558059 | Not Available | 986 | Open in IMG/M |
| 3300009137|Ga0066709_104515817 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300010136|Ga0127447_1016973 | Not Available | 1004 | Open in IMG/M |
| 3300010301|Ga0134070_10039602 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300010320|Ga0134109_10024545 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300010322|Ga0134084_10167508 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 749 | Open in IMG/M |
| 3300010323|Ga0134086_10086628 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300010325|Ga0134064_10195565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300012198|Ga0137364_11029863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
| 3300012199|Ga0137383_10128604 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300012202|Ga0137363_10517158 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1004 | Open in IMG/M |
| 3300012203|Ga0137399_10139276 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300012206|Ga0137380_10166733 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2007 | Open in IMG/M |
| 3300012210|Ga0137378_11084142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 715 | Open in IMG/M |
| 3300012211|Ga0137377_10882211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300012211|Ga0137377_11864489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300012359|Ga0137385_10002848 | All Organisms → cellular organisms → Bacteria | 14906 | Open in IMG/M |
| 3300012359|Ga0137385_11439271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300012361|Ga0137360_10205129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1598 | Open in IMG/M |
| 3300012918|Ga0137396_10178994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1553 | Open in IMG/M |
| 3300012918|Ga0137396_10974810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
| 3300012918|Ga0137396_11136887 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300012925|Ga0137419_11251781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300012927|Ga0137416_10129190 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300012927|Ga0137416_10329974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1273 | Open in IMG/M |
| 3300012927|Ga0137416_11270159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
| 3300012927|Ga0137416_12035066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300014166|Ga0134079_10135849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 977 | Open in IMG/M |
| 3300015054|Ga0137420_1107266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
| 3300015054|Ga0137420_1268261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300015241|Ga0137418_10858136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
| 3300018431|Ga0066655_10125242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1483 | Open in IMG/M |
| 3300018433|Ga0066667_10129474 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300018433|Ga0066667_10450855 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300018468|Ga0066662_10052162 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
| 3300018482|Ga0066669_10526859 | Not Available | 1026 | Open in IMG/M |
| 3300018482|Ga0066669_12317291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300019877|Ga0193722_1006790 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
| 3300019879|Ga0193723_1000369 | All Organisms → cellular organisms → Bacteria | 17585 | Open in IMG/M |
| 3300020022|Ga0193733_1109748 | Not Available | 767 | Open in IMG/M |
| 3300021086|Ga0179596_10350380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 741 | Open in IMG/M |
| 3300024224|Ga0247673_1046190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300025922|Ga0207646_10461175 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300026296|Ga0209235_1003132 | All Organisms → cellular organisms → Bacteria | 9214 | Open in IMG/M |
| 3300026296|Ga0209235_1055742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1874 | Open in IMG/M |
| 3300026304|Ga0209240_1070907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1296 | Open in IMG/M |
| 3300026313|Ga0209761_1117421 | Not Available | 1299 | Open in IMG/M |
| 3300026320|Ga0209131_1077032 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300026323|Ga0209472_1019908 | All Organisms → cellular organisms → Bacteria | 3222 | Open in IMG/M |
| 3300026326|Ga0209801_1040328 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300026334|Ga0209377_1223225 | Not Available | 621 | Open in IMG/M |
| 3300026335|Ga0209804_1216617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
| 3300026528|Ga0209378_1005753 | All Organisms → cellular organisms → Bacteria | 8028 | Open in IMG/M |
| 3300026528|Ga0209378_1027288 | All Organisms → cellular organisms → Bacteria | 3058 | Open in IMG/M |
| 3300026530|Ga0209807_1035809 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300026536|Ga0209058_1039482 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
| 3300026537|Ga0209157_1196976 | Not Available | 856 | Open in IMG/M |
| 3300027655|Ga0209388_1186284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
| 3300027671|Ga0209588_1000488 | All Organisms → cellular organisms → Bacteria | 10165 | Open in IMG/M |
| 3300027846|Ga0209180_10117830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1522 | Open in IMG/M |
| 3300027846|Ga0209180_10615550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
| 3300027875|Ga0209283_10068937 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300027882|Ga0209590_10003072 | All Organisms → cellular organisms → Bacteria | 6856 | Open in IMG/M |
| 3300028536|Ga0137415_10011674 | All Organisms → cellular organisms → Bacteria | 8719 | Open in IMG/M |
| 3300028536|Ga0137415_11224494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300028792|Ga0307504_10339446 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
| 3300031720|Ga0307469_10817690 | Not Available | 856 | Open in IMG/M |
| 3300031820|Ga0307473_10126838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1411 | Open in IMG/M |
| 3300032180|Ga0307471_100496828 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100012429 | 3300002558 | Grasslands Soil | MNPHIDLIYFFSSLVMVALPLGVFGWLTYRVVKAYWRDQKAASKAPR* |
| JGI25385J37094_100076523 | 3300002558 | Grasslands Soil | MNQHIDLIYFLSSLAMVVLPLGVFSWLTYLVIKAYRRERGQQNLR* |
| JGI25382J37095_101664812 | 3300002562 | Grasslands Soil | MNQHIDLIYFLSSLVMVVLPLGVFSWLTYLVIKGYRRERGQHNPR* |
| JGI25612J43240_10209722 | 3300002886 | Grasslands Soil | MNQHIDLIYFLSSLVLVALPLGVFSRLTYLVVNAYRRDLRAARQNPR* |
| JGI25382J43887_100455703 | 3300002908 | Grasslands Soil | MNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR* |
| JGI25382J43887_103872232 | 3300002908 | Grasslands Soil | MNPHIDLIYFLSSLVMVGLPLSVFGWLTYRVVKAYWRDQKAASRAPR* |
| Ga0066674_100369343 | 3300005166 | Soil | MNQHIDLIYFLSSLVMVVLPLGVFSWLTYLVIKTYRRERGQQNLR* |
| Ga0066674_101387592 | 3300005166 | Soil | MSPHIDLIYFLSSLVMVVLPLTVFSWLTYLVLKAYRRDQSAARKNSR* |
| Ga0066683_103216021 | 3300005172 | Soil | PMNQHIDLIYFLSSLVMVVLPLGVFSWLTYLVIKTYRRERGQQNLR* |
| Ga0066679_100760361 | 3300005176 | Soil | MNQHIDLIYFWSSLVLVALPLGIFSWMTWLVVKRYRHEMREKREDSSP* |
| Ga0066685_101724222 | 3300005180 | Soil | MNQHIDLIYFWSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR* |
| Ga0066678_100294013 | 3300005181 | Soil | MNQHIDLIYFLSSLAMVVLPLGVFSWLTYLVIKTYRRERGQQNLR* |
| Ga0066676_109431753 | 3300005186 | Soil | MNQHIDLIYFWSSLVLVALPLGVFSWLTYHVVNAYRRDLRAARKNPR* |
| Ga0066675_112158631 | 3300005187 | Soil | MNQQIDLIYFWSSLVLVALPLGIFSWMTWLVVKRYRHEMREKREDSSP* |
| Ga0070708_1000705456 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPHIDLIYFFSSLVMVGLPLSVFGWLTYRVVKAYWRDQKAASRAPR* |
| Ga0066689_104307671 | 3300005447 | Soil | MNPHIDLIYFFSSLVMVALPLGVFGWLTYRVVKAYWRDQKAA |
| Ga0070698_1000162219 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQHIDLIYFWSSLVLVALPLGVFSWLTYLVVAAYRRDLRAARKNPR* |
| Ga0066692_105570812 | 3300005555 | Soil | MNQHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR* |
| Ga0066707_100066933 | 3300005556 | Soil | MNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQERRQQNPR* |
| Ga0066699_112484212 | 3300005561 | Soil | MNQHIDLIYFFSSLVMVGLPLGLFTWLTYLVVKRYLAERRDNAEGGTRN* |
| Ga0066705_100512103 | 3300005569 | Soil | MNPHIDLIYFFSSLVMVGLPLGVFGWLTYRVVKAYWRDQKAASRAPR* |
| Ga0066702_100043539 | 3300005575 | Soil | MNQQIDLIYFWSSLVLVALPLGIFSWMTWLVVKRYRHEMREK |
| Ga0066706_103975582 | 3300005598 | Soil | ATLHRPMNPHIDLIYFFSSLVMVGLPLGVFGWLTYRVVKAYWRDQKAASRAPR* |
| Ga0066651_100178631 | 3300006031 | Soil | MSPHIDLIYFLSSLVMVVLPLTVFSWLTYLVLKAY |
| Ga0066651_101193301 | 3300006031 | Soil | PSTTVHRQMNQHIDLIYFLSSLVLVALPLGVFSWLTYLLVKRYLHELREKGAGRSP* |
| Ga0066696_106727692 | 3300006032 | Soil | MSQHIDLIYFFSSLVMVGLPLGLFTWLTYLVVKRYLAERRDNPEGGTRN* |
| Ga0066653_107524912 | 3300006791 | Soil | MNQHIDLIYFLSSLVLVALPLGVFSWLTYLLVKRYLHELREKGAGRSP* |
| Ga0075433_100685185 | 3300006852 | Populus Rhizosphere | MNPHIDLIYFFSSLLMVVLPLTVFTWLTYLVVKRYRQDQSAERKTPR* |
| Ga0075425_1017153981 | 3300006854 | Populus Rhizosphere | MNPHIDLIYFFSSLLMVVLPLTVFTWLTYLVVKRYRQDQSA |
| Ga0075426_104738983 | 3300006903 | Populus Rhizosphere | MNPHIDLIYFLSSLVMVALPLGVFTWLTYLVVQRYRRDQSAVSKNPR* |
| Ga0075435_1000665276 | 3300007076 | Populus Rhizosphere | MNPHIDLIYFFSSLLMVVLPLTVFTWLTYLVVKRYRQDQSAARKTPR* |
| Ga0075435_1009420713 | 3300007076 | Populus Rhizosphere | MNPHIDLIYFLSSLVMVALPLGVFTWLTYRVVQRYRRDQSAVRKNPR* |
| Ga0099791_102679343 | 3300007255 | Vadose Zone Soil | MNPHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR* |
| Ga0099794_100934693 | 3300007265 | Vadose Zone Soil | MNQHIDLIYFLSSLVLVALPLGVFSWLTYLVVSAYRRDQRAGSKHPR* |
| Ga0099794_102497662 | 3300007265 | Vadose Zone Soil | MNQHIDLIYFWSSLVLVALPVGVFSWLTYLVVKAYRQERGQQNPR* |
| Ga0099829_1000208313 | 3300009038 | Vadose Zone Soil | MNQHIDLIYFLSSLVMVVLPLGVFGWLSYLVIRGYRRERGQHNPR* |
| Ga0099829_108304632 | 3300009038 | Vadose Zone Soil | MNPHIDLIYFFSSLVMVGLPLGVFGWLTYRVVKAYWREQKAESRAPR* |
| Ga0099828_101250071 | 3300009089 | Vadose Zone Soil | NQHIDLIYFWSSLVLVALPVGVFSWLTYLVVKAYRQERGQQNPR* |
| Ga0099827_100345023 | 3300009090 | Vadose Zone Soil | MSQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR* |
| Ga0099827_105580592 | 3300009090 | Vadose Zone Soil | MSPHIDLIYFLSSLVLVALPLVVFSWLTYLVIKGYRQGPGQQNPR* |
| Ga0066709_1045158172 | 3300009137 | Grasslands Soil | IYFFSSLVMVALPLGVFGWLTYRVVKAYWRDQKAASKAPR* |
| Ga0127447_10169732 | 3300010136 | Grasslands Soil | MSPHIDLIYFLSSLVMVVLPLGVFSWLTYLVIKTYRRERGQQNLR* |
| Ga0134070_100396025 | 3300010301 | Grasslands Soil | MNQHIDLIYFWSSLVLVALPVGVFSCLTWLVVKRYRHE |
| Ga0134109_100245453 | 3300010320 | Grasslands Soil | MNQHIDLIYFWSSLVLVALPVGVFSCLTWLVVKRYRHEMREKGEGN* |
| Ga0134084_101675083 | 3300010322 | Grasslands Soil | MNPHIDLIYFLSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR* |
| Ga0134086_100866282 | 3300010323 | Grasslands Soil | MNQHIDLIYFLSSLVMVVLPLGVFSWLNYLVIKTYRRERGQQNLR* |
| Ga0134064_101955652 | 3300010325 | Grasslands Soil | MNQHIDLIYFWSSLVLVALPVGVFSCLTWLVVKRYRHEMREKREGRGT* |
| Ga0137364_110298631 | 3300012198 | Vadose Zone Soil | MNQHIDLIYFWSSLVLVALPVGVFSCLTWLVVKRYRHEMRET |
| Ga0137383_101286043 | 3300012199 | Vadose Zone Soil | MNQHIDLIYFLSSLVLVALPLGVFSRLTYLLVKRYLHELREKGEGRSP* |
| Ga0137363_105171583 | 3300012202 | Vadose Zone Soil | MNQHIDLIYFLSSLVLVALPLGVFSRLTYLVVNAYRRDLRAARKHPR* |
| Ga0137399_101392762 | 3300012203 | Vadose Zone Soil | MTQHIDLIYFWSSLVLVALPVGIFSWMTWLLVKRYRHEMREKGEGH* |
| Ga0137380_101667333 | 3300012206 | Vadose Zone Soil | MNQQIDLIYFWSSLVLVALPLGIFSWLSYLVIRGYRRERGQHNPR* |
| Ga0137378_110841422 | 3300012210 | Vadose Zone Soil | MSPHIDLIYFLSSLVLVALPLVVFSWLTYLVIKGYRQGRRQQNPR* |
| Ga0137377_108822113 | 3300012211 | Vadose Zone Soil | MSQHIDLIYFFSSLVLVALPLLVFSWLTYLVIKGYRQGPPQHNPR* |
| Ga0137377_118644892 | 3300012211 | Vadose Zone Soil | MNRHIDLIYFLSSLVMVVLPLGVFSWLTYLVIKTYRRERGQQNLR* |
| Ga0137385_100028481 | 3300012359 | Vadose Zone Soil | LIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLREARKNPR* |
| Ga0137385_114392711 | 3300012359 | Vadose Zone Soil | MNQHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYR |
| Ga0137360_102051292 | 3300012361 | Vadose Zone Soil | MNQHIDLIYFCSSLVLVALPLGVFSRLTYLVVNAYRRDLRAARKNPR* |
| Ga0137396_101789943 | 3300012918 | Vadose Zone Soil | MNPHIDLIYFWSSLVLVALPLGVFSWLTYLVVSAYRRDLRAARKNPR* |
| Ga0137396_109748101 | 3300012918 | Vadose Zone Soil | MSQQIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0137396_111368871 | 3300012918 | Vadose Zone Soil | HIDLIYFLSSLVLVALPLGVFSWLTYLVVSAYRRDQRAGSKHPR* |
| Ga0137419_112517813 | 3300012925 | Vadose Zone Soil | MNQQIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQ |
| Ga0137416_101291901 | 3300012927 | Vadose Zone Soil | MNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRPQNPR* |
| Ga0137416_103299742 | 3300012927 | Vadose Zone Soil | MNPHIDLIYFWSSLVLVALPLGVFSWLTYLVVSAYRRDLRAARKNLR* |
| Ga0137416_112701591 | 3300012927 | Vadose Zone Soil | MNQQIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0137416_120350661 | 3300012927 | Vadose Zone Soil | MNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRR |
| Ga0134079_101358492 | 3300014166 | Grasslands Soil | MNQQIDLIYFWSSLVLVALPLGIFSWMTWLVVKRYRHEMREKEEGRGT* |
| Ga0137420_11072662 | 3300015054 | Vadose Zone Soil | MNQQIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR* |
| Ga0137420_12682611 | 3300015054 | Vadose Zone Soil | IYFYLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR* |
| Ga0137418_108581363 | 3300015241 | Vadose Zone Soil | MSQHIDLIYFWSSLVLVALPLGIFSWMTWLLVKRYRREMRETGEGRST* |
| Ga0066655_101252422 | 3300018431 | Grasslands Soil | MNQHIDLIYFLSSLVMVVLPLGVFSWLTYLVIKTYRRERGQQNLR |
| Ga0066667_101294743 | 3300018433 | Grasslands Soil | ALHRPMNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQERRQQNPR |
| Ga0066667_104508553 | 3300018433 | Grasslands Soil | MSPHIDLIYFLSSLVMVVLPLTVFGWLTYLVLKAYRRDQSAARKNSR |
| Ga0066662_100521625 | 3300018468 | Grasslands Soil | MNPHIDLIYFFSSLVMVALPLGVFGWLTYRVVKAYWRDQKAASKAPR |
| Ga0066669_105268592 | 3300018482 | Grasslands Soil | MNPQIDLIYFLSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR |
| Ga0066669_123172913 | 3300018482 | Grasslands Soil | MSPHIDLIYFLSSLVMVVLPLTVFSWLTYLVLKAYRRDQSAGRKKSR |
| Ga0193722_10067903 | 3300019877 | Soil | MNQHIDLIYFLSSLVMVVFPLAVFTWLTYLVVKAYRRDQSAVRKNPR |
| Ga0193723_100036912 | 3300019879 | Soil | MNQQIDLIYFWSSLALVALPLGIFSWLSYLVIRGYRRERGQHNPR |
| Ga0193733_11097482 | 3300020022 | Soil | MNQHIDLIYFWSSLVLVALPLGIFSWMTWLLVKRYRHEMREKGEGRRSL |
| Ga0179596_103503802 | 3300021086 | Vadose Zone Soil | MNPHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR |
| Ga0247673_10461902 | 3300024224 | Soil | MNPHIDLIYFLSSLVMVALPLGVFTWLTYLVVQRYRRDQSAVSKNPR |
| Ga0207646_104611751 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLIYFFSSLVMVGLPLSVFGWLTYRVVKAYWRDQKAASRAPR |
| Ga0209235_10031325 | 3300026296 | Grasslands Soil | MNQHIDLIYFLSSLAMVVLPLGVFSWLTYLVIKAYRRERGQQNLR |
| Ga0209235_10557422 | 3300026296 | Grasslands Soil | MNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0209240_10709073 | 3300026304 | Grasslands Soil | MNQHIDLIYFLSSLVLVALPLGVFSRLTYLVVNAYRRDLRAARQNPR |
| Ga0209761_11174212 | 3300026313 | Grasslands Soil | MSQHIDLIYFFSSLVLVALPVLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0209131_10770322 | 3300026320 | Grasslands Soil | MNQHIDLIYFLSSLVLVALPLGVFSRLTYLVVNAYRRDLRAARKHPR |
| Ga0209472_10199084 | 3300026323 | Soil | MSPHIDLIYFLSSLVMVVLPLTVFSWLTYLVLKAYRRDQSAARKNSR |
| Ga0209801_10403283 | 3300026326 | Soil | MNQHIDLIYFLSSLAMVVLPLGVFSWLTYLVIKTYRRERGQQNLR |
| Ga0209377_12232251 | 3300026334 | Soil | QHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR |
| Ga0209804_12166171 | 3300026335 | Soil | MNQHIDLIYFWSSLVLVALPLGIFSWMTWLVVKRYRHEMREKRE |
| Ga0209378_10057538 | 3300026528 | Soil | MNQHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR |
| Ga0209378_10272883 | 3300026528 | Soil | MNQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQERRQQNPR |
| Ga0209807_10358093 | 3300026530 | Soil | MNPHIDLIYFFSSLVMVGLPLGVFGWLTYRVVKAYWRDQKAASRAPR |
| Ga0209058_10394826 | 3300026536 | Soil | MNQHIDLIYFWSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0209157_11969761 | 3300026537 | Soil | SAPSAALHRPMNQHIDLIYFWSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0209388_11862843 | 3300027655 | Vadose Zone Soil | MNPHIDLIYFWSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNP |
| Ga0209588_10004885 | 3300027671 | Vadose Zone Soil | MNQHIDLIYFLSSLVLVALPLGVFSWLTYLVVSAYRRDQRAGSKHPR |
| Ga0209180_101178303 | 3300027846 | Vadose Zone Soil | MNQHIDLIYFLSSLVMVVLPLGVFGWLSYLVIRGYRRERGQHNPR |
| Ga0209180_106155502 | 3300027846 | Vadose Zone Soil | MNQHIDLIYFWSSLVLVALPVGVFSWLTYLVVKAYRQERGQQNPR |
| Ga0209283_100689373 | 3300027875 | Vadose Zone Soil | NQHIDLIYFWSSLVLVALPVGVFSWLTYLVVKAYRQERGQQNPR |
| Ga0209590_100030723 | 3300027882 | Vadose Zone Soil | MSQHIDLIYFLSSLVLVALPLLVFSWLTYLVIKGYRQGRRQQNPR |
| Ga0137415_100116743 | 3300028536 | Vadose Zone Soil | MTQHIDLIYFWSSLVLVALPVGIFSWMTWLLVKRYRHEMREKGEGH |
| Ga0137415_112244942 | 3300028536 | Vadose Zone Soil | IYFWSSLVLVALPLGIFSWMTWLLVKRYRREMREKGEGRST |
| Ga0307504_103394462 | 3300028792 | Soil | MNPHIDLIYFLSSLVLVALPLGVFSWLTYLVVNAYRRDLRAARKNPR |
| Ga0307469_108176902 | 3300031720 | Hardwood Forest Soil | MNPHIDLIYFFSSLLMVVLPLTVFTWLTYLVVKRYRQDQSAARKTPR |
| Ga0307473_101268382 | 3300031820 | Hardwood Forest Soil | MNPHIDLIYFFSSLLMVVLPLTVFSWLTYLVVKRYRQDQSAARKTPR |
| Ga0307471_1004968282 | 3300032180 | Hardwood Forest Soil | MNPHIDLIYFFSSLVMVGLPLSVFGWLTYRVVKAYWRDQKAASRAPR |
| ⦗Top⦘ |