


| Basic Information | |
|---|---|
| Family ID | F090153 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 49 residues |
| Representative Sequence | NGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.67 % |
| % of genes near scaffold ends (potentially truncated) | 95.37 % |
| % of genes from short scaffolds (< 2000 bps) | 87.96 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.074 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.741 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.259 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.25% β-sheet: 0.00% Coil/Unstructured: 65.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 1.85 |
| PF09932 | DUF2164 | 1.85 |
| PF05068 | MtlR | 0.93 |
| PF13578 | Methyltransf_24 | 0.93 |
| PF11578 | DUF3237 | 0.93 |
| PF03167 | UDG | 0.93 |
| PF03544 | TonB_C | 0.93 |
| PF02371 | Transposase_20 | 0.93 |
| PF00211 | Guanylate_cyc | 0.93 |
| PF02806 | Alpha-amylase_C | 0.93 |
| PF04389 | Peptidase_M28 | 0.93 |
| PF01011 | PQQ | 0.93 |
| PF13884 | Peptidase_S74 | 0.93 |
| PF13181 | TPR_8 | 0.93 |
| PF13271 | DUF4062 | 0.93 |
| PF07077 | DUF1345 | 0.93 |
| PF14534 | DUF4440 | 0.93 |
| PF09348 | DUF1990 | 0.93 |
| PF01872 | RibD_C | 0.93 |
| PF04519 | Bactofilin | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF08734 | GYD | 0.93 |
| PF10518 | TAT_signal | 0.93 |
| PF07366 | SnoaL | 0.93 |
| PF13185 | GAF_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.93 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.93 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.93 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.93 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG3722 | DNA-binding transcriptional regulator, MltR family | Transcription [K] | 0.93 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.93 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.07 % |
| Unclassified | root | N/A | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16599147 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 2088090014|GPIPI_17341168 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 2170459007|GJ61VE201DSE00 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 506 | Open in IMG/M |
| 3300000953|JGI11615J12901_10577673 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300002903|JGI24801J43971_1004273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 666 | Open in IMG/M |
| 3300004016|Ga0058689_10170885 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300004114|Ga0062593_100352852 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 1287 | Open in IMG/M |
| 3300004114|Ga0062593_103253735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 3300004157|Ga0062590_100243098 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 1347 | Open in IMG/M |
| 3300004463|Ga0063356_100699099 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300004480|Ga0062592_100991450 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005167|Ga0066672_10077069 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300005180|Ga0066685_10207126 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300005186|Ga0066676_10076029 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300005289|Ga0065704_10351131 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005294|Ga0065705_10271122 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005294|Ga0065705_10276340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300005294|Ga0065705_10365193 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 929 | Open in IMG/M |
| 3300005294|Ga0065705_10530072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 754 | Open in IMG/M |
| 3300005332|Ga0066388_101271829 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300005332|Ga0066388_103637931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 787 | Open in IMG/M |
| 3300005332|Ga0066388_104930116 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005332|Ga0066388_105357452 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005332|Ga0066388_106691877 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005332|Ga0066388_107291341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 555 | Open in IMG/M |
| 3300005366|Ga0070659_101927627 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005439|Ga0070711_101819046 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005467|Ga0070706_100249176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum | 1658 | Open in IMG/M |
| 3300005467|Ga0070706_100650628 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300005529|Ga0070741_10291692 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300005540|Ga0066697_10068206 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300005556|Ga0066707_10092474 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300005558|Ga0066698_10253074 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300005713|Ga0066905_101071185 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005764|Ga0066903_100149711 | All Organisms → cellular organisms → Bacteria | 3349 | Open in IMG/M |
| 3300005764|Ga0066903_101024178 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300005764|Ga0066903_102865770 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005764|Ga0066903_103667572 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005764|Ga0066903_105553084 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005764|Ga0066903_106923973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 588 | Open in IMG/M |
| 3300005764|Ga0066903_107975114 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006031|Ga0066651_10048219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1983 | Open in IMG/M |
| 3300006034|Ga0066656_10720266 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300006046|Ga0066652_100072057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 2695 | Open in IMG/M |
| 3300006796|Ga0066665_10046588 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
| 3300006796|Ga0066665_11345763 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006871|Ga0075434_100831599 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006904|Ga0075424_102875910 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009100|Ga0075418_12097740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
| 3300009162|Ga0075423_11495784 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009162|Ga0075423_12325269 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010043|Ga0126380_10332049 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1097 | Open in IMG/M |
| 3300010046|Ga0126384_10961675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 775 | Open in IMG/M |
| 3300010325|Ga0134064_10136559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300010337|Ga0134062_10114050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1172 | Open in IMG/M |
| 3300010360|Ga0126372_10463028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Aminobacter → Aminobacter anthyllidis | 1179 | Open in IMG/M |
| 3300010360|Ga0126372_11782966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 658 | Open in IMG/M |
| 3300010360|Ga0126372_12670010 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010376|Ga0126381_101285759 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300010398|Ga0126383_11999895 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012200|Ga0137382_10854373 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012203|Ga0137399_10027134 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3879 | Open in IMG/M |
| 3300012207|Ga0137381_10261340 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1505 | Open in IMG/M |
| 3300012209|Ga0137379_10700734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 918 | Open in IMG/M |
| 3300012285|Ga0137370_10201693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1167 | Open in IMG/M |
| 3300012285|Ga0137370_10277423 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 997 | Open in IMG/M |
| 3300012930|Ga0137407_10626410 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 1011 | Open in IMG/M |
| 3300012948|Ga0126375_10343483 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300012960|Ga0164301_10188633 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012971|Ga0126369_12456317 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300013296|Ga0157374_10058733 | All Organisms → cellular organisms → Bacteria | 3595 | Open in IMG/M |
| 3300013296|Ga0157374_10115857 | All Organisms → cellular organisms → Bacteria | 2582 | Open in IMG/M |
| 3300014968|Ga0157379_10010755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 7975 | Open in IMG/M |
| 3300015358|Ga0134089_10298784 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300015371|Ga0132258_10257102 | All Organisms → cellular organisms → Bacteria | 4273 | Open in IMG/M |
| 3300015373|Ga0132257_100561548 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300015374|Ga0132255_104054736 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300016404|Ga0182037_10998762 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300017659|Ga0134083_10062161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1423 | Open in IMG/M |
| 3300019886|Ga0193727_1030388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1856 | Open in IMG/M |
| 3300021171|Ga0210405_10407601 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1070 | Open in IMG/M |
| 3300022756|Ga0222622_10310772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1087 | Open in IMG/M |
| 3300022756|Ga0222622_11106083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300024279|Ga0247692_1007145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1770 | Open in IMG/M |
| 3300025910|Ga0207684_10847741 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300025929|Ga0207664_11515165 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 592 | Open in IMG/M |
| 3300025932|Ga0207690_10620585 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300026327|Ga0209266_1110865 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300026335|Ga0209804_1114952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1226 | Open in IMG/M |
| 3300026551|Ga0209648_10068741 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
| 3300026551|Ga0209648_10103693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2326 | Open in IMG/M |
| 3300026552|Ga0209577_10164289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1734 | Open in IMG/M |
| 3300027444|Ga0207468_1004547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 710 | Open in IMG/M |
| 3300027873|Ga0209814_10310981 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300030499|Ga0268259_10144767 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300030916|Ga0075386_10019742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 757 | Open in IMG/M |
| 3300031231|Ga0170824_102999992 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031910|Ga0306923_10905126 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300031942|Ga0310916_11341925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 587 | Open in IMG/M |
| 3300031947|Ga0310909_10925853 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031954|Ga0306926_10527630 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300031954|Ga0306926_11223472 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300031954|Ga0306926_12556225 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032001|Ga0306922_11259434 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300032179|Ga0310889_10168995 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300033289|Ga0310914_10709270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 902 | Open in IMG/M |
| 3300033551|Ga0247830_11150570 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002903 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um Nextera | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027444 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00840110 | 2088090014 | Soil | AHREFNAYPGVQAWWRLRSHWFSKEFVKFVDQMQQTAGPPGMYREANADE |
| GPIPI_01824440 | 2088090014 | Soil | HLDARVWYGWEAAMDDLNGYPGVQGWWRLRSHWFHEDFAEHINQLQQTAKARRMYGEPMKDE |
| L02_01924430 | 2170459007 | Grass Soil | GWEAAHREFNAYPGVQAWWRLRSHWFSKEFVKFVDQLQQTAGPPRMYREPMKDE |
| FG2_08486700 | 2189573004 | Grass Soil | YVWHGMEAGMREFSGYPGVQAWWRFRSHWFTEKFAKHIKQLQETAKPPRMYREAMEDE |
| JGI11615J12901_105776731 | 3300000953 | Soil | HLEGHLDARVWYGWEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTANPPRLFREPMEDE* |
| JGI24801J43971_10042733 | 3300002903 | Soil | MCGXGXEAGMREFSGYPGIQAWWRFRSHWFSEEFAKHINHLQQTAKPPR |
| Ga0058689_101708851 | 3300004016 | Agave | GWEAAMNELNGYPGVQGWWRSRSHWFHEDFAKHINQLQQTAKPPRLYRESNADH* |
| Ga0062593_1003528521 | 3300004114 | Soil | HLEGHLDARVWYGWEAAMNELNGYPGVQGWWRSRSHWFHEDFANLVNQLQRTATAPRLYGEPMEDE* |
| Ga0062593_1032537351 | 3300004114 | Soil | PGVQAWWRSHSHWFGGEDFAKFINQQQQTAKPPRMFGEANPDQ* |
| Ga0062590_1002430984 | 3300004157 | Soil | LEGHLDARVWYGWEAAMNELNGYPGVQGWWRSRSHWFHEDFANLVNQLQRTATAPRLYGEPMEDE* |
| Ga0063356_1006990991 | 3300004463 | Arabidopsis Thaliana Rhizosphere | WEAAMNDLNGYPGVQGWWRSRSHWFHEDFANLVNQLQRTATAPRLYGEPMEDE* |
| Ga0062592_1009914502 | 3300004480 | Soil | WEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE* |
| Ga0066672_100770691 | 3300005167 | Soil | MRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPTLYREPIGDE* |
| Ga0066685_102071263 | 3300005180 | Soil | PGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0066676_100760294 | 3300005186 | Soil | MRGLINRWPGIQAWWREYSDWFSEEFANYVNQLQQIDKRPSLYREPD |
| Ga0065704_103511312 | 3300005289 | Switchgrass Rhizosphere | YPGVQAWWRLRSHWFSEEFVKFVDQMQQTAGAPRMYREPMKDE* |
| Ga0065705_102711223 | 3300005294 | Switchgrass Rhizosphere | HLDARVWYGWEAAMNELNGYPGVQGWWRSRSHWFHEDFANLVNQLQRTAKPPRLYREPMKDE* |
| Ga0065705_102763401 | 3300005294 | Switchgrass Rhizosphere | FNAYPGVQAWWRLRSHWFSKEFVKFVDQMQQTAGPPRLYREPMEDE* |
| Ga0065705_103651933 | 3300005294 | Switchgrass Rhizosphere | AWWRLRSHWFSKEFVKFVDQMQQTAGPPRMYREPMKDER* |
| Ga0065705_105300721 | 3300005294 | Switchgrass Rhizosphere | MNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE* |
| Ga0066388_1012718292 | 3300005332 | Tropical Forest Soil | YPGVQAWWRLRSHWFSEEFVKFVDQAQQTAGPPRLYREPMEDE* |
| Ga0066388_1036379312 | 3300005332 | Tropical Forest Soil | NACPGVQAWWRSRSHWFGGEEFAKFIDQQQQKAKAPGMYREPMKDE* |
| Ga0066388_1049301162 | 3300005332 | Tropical Forest Soil | MWHETEGSLRDFIAYPGIQAWWRLRSHWFSEEFVKFIDQAQQTAGPPRLYRETNER* |
| Ga0066388_1053574523 | 3300005332 | Tropical Forest Soil | YPGVQAWWRLRSHWFSEEFVKFVDQAQQTAGPPRLYREPMNDE* |
| Ga0066388_1066918771 | 3300005332 | Tropical Forest Soil | YPGVQAWWRSRSHWFSEEFAKHIDQLQQIAKPPRLYREPMKDE* |
| Ga0066388_1072913411 | 3300005332 | Tropical Forest Soil | VQAWWRSRSHWFSEDFAKHINQLQQTAKAPQMYREPMKDE* |
| Ga0070659_1019276271 | 3300005366 | Corn Rhizosphere | QAWWRSRSHWFHEDFAKHVNKRQQTAEPPRMYRESMEEEG* |
| Ga0070711_1018190461 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE* |
| Ga0070706_1002491761 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPNADH* |
| Ga0070706_1006506281 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPNADH* |
| Ga0070741_102916924 | 3300005529 | Surface Soil | INGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPNADH* |
| Ga0066697_100682064 | 3300005540 | Soil | WRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0066707_100924741 | 3300005556 | Soil | RSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0066698_102530741 | 3300005558 | Soil | AYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0066905_1010711853 | 3300005713 | Tropical Forest Soil | MRDINTYPGVQAWWRSRSHWYSEEGFANYINQQQQTAKAPRLYREENPDR* |
| Ga0066903_1001497117 | 3300005764 | Tropical Forest Soil | GYPGVQAWWRLRSHWFSEKFVKFVDQMQQTAKPPRGFREAIPDQRFD* |
| Ga0066903_1010241781 | 3300005764 | Tropical Forest Soil | DINAYPGVQAWWRLRSHWFSEKFVKFIDQAQQTAGPPRLYREPMKDE* |
| Ga0066903_1028657703 | 3300005764 | Tropical Forest Soil | DVNAYPGVQAWWRSRSHWFSEEFAKQVNQEQQTAKAPRLFGEAKPDQ* |
| Ga0066903_1036675722 | 3300005764 | Tropical Forest Soil | YPGVQAWWRLRSHWFSEKFVKFIDQAQQSAGPPRMYREPMKDE* |
| Ga0066903_1055530841 | 3300005764 | Tropical Forest Soil | AMRDVNAYPGVQAWWRSRSHWFSEEFAKRVNQEQQTAKTPRLFREPMKDK* |
| Ga0066903_1069239732 | 3300005764 | Tropical Forest Soil | MRDINGYPGVQVWWRSRSHWFSEKFANHINQIQQTAKPPRLYSEPMEDE* |
| Ga0066903_1079751141 | 3300005764 | Tropical Forest Soil | QAWWRSRSHWFSEEFAKQVNQEQQTAKAPRLFREPHVDQ* |
| Ga0066651_100482193 | 3300006031 | Soil | INGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0066656_107202663 | 3300006034 | Soil | VQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPLGDQ* |
| Ga0066652_1000720571 | 3300006046 | Soil | GVQAWWRSRSHFFSEEFANHISQLQQTAKAPRLYREANPDQ* |
| Ga0066665_100465881 | 3300006796 | Soil | YPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0066665_113457631 | 3300006796 | Soil | APRRDFSAYPGVQAWWRSRSHWFSEDFANLVNQLQRTAKAPRLFGERMED* |
| Ga0075434_1008315991 | 3300006871 | Populus Rhizosphere | WWRTRWHRFNKEFVKHINQLQQTAKPPRMYRERMEDQ* |
| Ga0075424_1028759102 | 3300006904 | Populus Rhizosphere | VQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPMGGE* |
| Ga0075418_120977401 | 3300009100 | Populus Rhizosphere | PMGDINAYPGIQAWWRSRSHWFPEDFAKHVHQRQQTAKAPKLFREPMEGE* |
| Ga0075423_114957843 | 3300009162 | Populus Rhizosphere | GWEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAGPPTMYREPMKDE* |
| Ga0075423_123252691 | 3300009162 | Populus Rhizosphere | GWEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE* |
| Ga0126380_103320491 | 3300010043 | Tropical Forest Soil | MRDVNAYPGVQAWWRSRSHWFSEEFAKQVNQEQQTAKAPRLFREPNADQ* |
| Ga0126384_109616752 | 3300010046 | Tropical Forest Soil | SRSHWFSEELAKVVNEVQQTAKAPSMYREPMEDQ* |
| Ga0134064_101365591 | 3300010325 | Grasslands Soil | PGVQAYWRSRSHWDSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0134062_101140501 | 3300010337 | Grasslands Soil | NGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0126372_104630281 | 3300010360 | Tropical Forest Soil | NAYPGVRAWSRTRSHWFSEEYAKHIDQLQQTAEPPRLYREAMKDE* |
| Ga0126372_117829662 | 3300010360 | Tropical Forest Soil | GVQAWWRSRSHWFSEEFAKQVNQEQQTAKAPRLFREPMKDE* |
| Ga0126372_126700103 | 3300010360 | Tropical Forest Soil | LEGDVDPRLWRGWEAAMRDINGYLGVQAYWRSRSHWFNEEFVKFINQLQQTAKPPRLYREPREDE* |
| Ga0126381_1012857592 | 3300010376 | Tropical Forest Soil | GVQAWWRSRSHHFSEEFVKFIDQQQQTAGPPTLYRKPMKDE* |
| Ga0126383_119998952 | 3300010398 | Tropical Forest Soil | LRSHWFSEEFVKFINQLQQKAGPPRLYREPMKDE* |
| Ga0137382_108543731 | 3300012200 | Vadose Zone Soil | DLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE* |
| Ga0137399_100271349 | 3300012203 | Vadose Zone Soil | WRGWEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPLGDQ* |
| Ga0137381_102613403 | 3300012207 | Vadose Zone Soil | EAAHRDFNAYPGVQAWWRLRSHWFSEEFVKFVDQMQQTAGPPRLYREPMEDE* |
| Ga0137379_107007341 | 3300012209 | Vadose Zone Soil | DINAYPGVQAWWRLRLHWFHEDFAKHIDQLQQTAKPPRMFREPIADQ* |
| Ga0137370_102016931 | 3300012285 | Vadose Zone Soil | NAYPGVQAWWRLRLHWFHEDFAKHIDQLQQTAKPPRMFREPIADQ* |
| Ga0137370_102774232 | 3300012285 | Vadose Zone Soil | DINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE* |
| Ga0137407_106264102 | 3300012930 | Vadose Zone Soil | QAWWRSRSHWFSEEFAKFVDQVQQTAKPSRLYRKAKADQ* |
| Ga0126375_103434832 | 3300012948 | Tropical Forest Soil | AMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPKLYREPNSDH* |
| Ga0164301_101886331 | 3300012960 | Soil | YPGVQAWWRLRSHWFSEEFVKFVDQMQQTAGPPRMYREPMKDE* |
| Ga0126369_124563171 | 3300012971 | Tropical Forest Soil | AWWRSHAQYLSEKFVKFVDQLQQTAEPPRLYREPMKDE* |
| Ga0157374_100587331 | 3300013296 | Miscanthus Rhizosphere | GVQAWWRLRSHWFSKEFVTFVDQMQQTAGPPGMYREANADE* |
| Ga0157374_101158573 | 3300013296 | Miscanthus Rhizosphere | NDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTANPPRLFREPMEDE* |
| Ga0157379_1001075513 | 3300014968 | Switchgrass Rhizosphere | WEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTANPPRLFREPMEDE* |
| Ga0134089_102987843 | 3300015358 | Grasslands Soil | AHRDFNAYPGVQAWWRLRSHWFSEEFVKFVDQMQQTAGPPRMYREPMKDE* |
| Ga0132258_102571028 | 3300015371 | Arabidopsis Rhizosphere | GWEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPNADH* |
| Ga0132257_1005615481 | 3300015373 | Arabidopsis Rhizosphere | AAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE* |
| Ga0132255_1040547361 | 3300015374 | Arabidopsis Rhizosphere | LDAREWYGWEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKPINQLQQTANPPRLFREPMEDE* |
| Ga0182037_109987621 | 3300016404 | Soil | IRDINAYPGVQAWWRLRSHWFSEKFVKFIDQAQQTAGPPRMYREPMKDE |
| Ga0134083_100621611 | 3300017659 | Grasslands Soil | MRDINAYPGVQAWWRLRSHWFHEDFAKHIDQLQQTAKPPRMFREPIADQ |
| Ga0193727_10303881 | 3300019886 | Soil | EAAHRDFNAYPGVQAWWRLRSHWFSKEFVKFVDQMQQTVGPPRMYREPMKDE |
| Ga0210405_104076011 | 3300021171 | Soil | RDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPSPDQ |
| Ga0222622_103107721 | 3300022756 | Groundwater Sediment | WYGWEAAMNDLNGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE |
| Ga0222622_111060831 | 3300022756 | Groundwater Sediment | IGYSGIQAWWRLRSHWFSEEFVNHINQLQQTAKPARLYREPMKDE |
| Ga0247692_10071451 | 3300024279 | Soil | WRGWEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPNADH |
| Ga0207684_108477412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | WWRLRSHWFHEDFAKHINQLQQTAKARRMYGEPMKDE |
| Ga0207664_115151652 | 3300025929 | Agricultural Soil | HLEGHLDARVWYGWEAAMNELNGYPGVQGWWRSRSHWFHEDFANLVNQLQRTATAPRLYGEPMEDE |
| Ga0207690_106205853 | 3300025932 | Corn Rhizosphere | LYEEAYYRHLEGHLDARVWYGWEAAMNELSGYPGVQGWWRLRSHWFHEDFAKHINQLQQTAKARRTYGEPMKDE |
| Ga0209266_11108654 | 3300026327 | Soil | VNGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPSPDQ |
| Ga0209804_11149523 | 3300026335 | Soil | LWRGWEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPTLYREPIGDE |
| Ga0209648_100687411 | 3300026551 | Grasslands Soil | WEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPARLYREPIGDE |
| Ga0209648_101036931 | 3300026551 | Grasslands Soil | WEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPIGDE |
| Ga0209577_101642893 | 3300026552 | Soil | WRGWEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPTLYREPIGDE |
| Ga0207468_10045473 | 3300027444 | Soil | LWRGWEAAMRDINGYPGVQAYWRSRSHWFGEEFAKLINERQQTAKPPRLYREPMGDE |
| Ga0209814_103109812 | 3300027873 | Populus Rhizosphere | MLEVPMGDINAYPGIQAWWRSRSHWFPEDFAKHVNQRQQTAKAPKLFREPMEGE |
| Ga0268259_101447671 | 3300030499 | Agave | GWEAAMNELNGYPGVQGWWRSRSHWFHEDFAKHINQLQQTAKPPRLYRESNADH |
| Ga0075386_100197423 | 3300030916 | Soil | QAWWRSRSHWFTEEFAKLINQLQQTAKPPTLYREPMEDE |
| Ga0170824_1029999922 | 3300031231 | Forest Soil | FEAAMRDFNAYPGVQAWWRSRSHWFHKEFATFIAQQQQTAKAPRLYREENADQ |
| Ga0306923_109051263 | 3300031910 | Soil | AVIRDINAYPGVQAWWRLRSHWFSEKFVKFIDQAQQTAGPPRMYREPMKDE |
| Ga0310916_113419251 | 3300031942 | Soil | MRDINAYPGVQAWWRSRSHWFSEKFVKFVDQAQQTAGPPRMYREPMKDE |
| Ga0310909_109258531 | 3300031947 | Soil | YVWNGLEASMRDFNGYPGVQAWWRFRSHWFSEGFAKHINQLQETAPPPRMYREPNAGQ |
| Ga0306926_105276301 | 3300031954 | Soil | DINAYPGVQAWWRSRSHWFSEKFVKFVDQAQQTAGPPRMYREPMKDE |
| Ga0306926_112234722 | 3300031954 | Soil | AMNELNGYPGVQGWWRSRSHWFHEDFAKHINQLQQTAKPPRLYREPMKDE |
| Ga0306926_125562253 | 3300031954 | Soil | VNWEAGIRDINAYPGVQAWWRLRSHWFSEKFVKYIDQAQQTAGPPRMYREPMKDE |
| Ga0306922_112594343 | 3300032001 | Soil | PEVQAWWRSCSHWFGGEDFAKFIDQQQQTAKPPRSFREAMKDE |
| Ga0310889_101689951 | 3300032179 | Soil | RLWRGWEAAMRDINGYPGVQAYWRSRSHWYSEEFAKYINQLQQTAKPPRLYREPNADH |
| Ga0310914_107092701 | 3300033289 | Soil | YPGVQAWWRLRSHWFSEKFVKFIDQAQQTAGPPRMYREPMKDE |
| Ga0247830_111505701 | 3300033551 | Soil | TAHRDFNAYPGVQAWWRLRSHWFSKEFVKFVDQMQQTAGPPRMYREPMKDE |
| ⦗Top⦘ |