


| Basic Information | |
|---|---|
| Family ID | F089978 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MLADGTITARIRSTVELDGAGQVLGKLRSGGLRGKAVIRL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 25.93 % |
| % of genes near scaffold ends (potentially truncated) | 62.96 % |
| % of genes from short scaffolds (< 2000 bps) | 87.04 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.630 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.815 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.370 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 0.00% Coil/Unstructured: 80.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 2.78 |
| PF02467 | Whib | 2.78 |
| PF13191 | AAA_16 | 1.85 |
| PF12831 | FAD_oxidored | 1.85 |
| PF00582 | Usp | 1.85 |
| PF00196 | GerE | 1.85 |
| PF06480 | FtsH_ext | 1.85 |
| PF00440 | TetR_N | 1.85 |
| PF13473 | Cupredoxin_1 | 1.85 |
| PF13470 | PIN_3 | 0.93 |
| PF00873 | ACR_tran | 0.93 |
| PF05690 | ThiG | 0.93 |
| PF01734 | Patatin | 0.93 |
| PF13556 | HTH_30 | 0.93 |
| PF01741 | MscL | 0.93 |
| PF03060 | NMO | 0.93 |
| PF06628 | Catalase-rel | 0.93 |
| PF04261 | Dyp_perox | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF00528 | BPD_transp_1 | 0.93 |
| PF07995 | GSDH | 0.93 |
| PF00004 | AAA | 0.93 |
| PF04916 | Phospholip_B | 0.93 |
| PF00296 | Bac_luciferase | 0.93 |
| PF04909 | Amidohydro_2 | 0.93 |
| PF07676 | PD40 | 0.93 |
| PF13533 | Biotin_lipoyl_2 | 0.93 |
| PF00210 | Ferritin | 0.93 |
| PF17131 | LolA_like | 0.93 |
| PF01610 | DDE_Tnp_ISL3 | 0.93 |
| PF00529 | CusB_dom_1 | 0.93 |
| PF02678 | Pirin | 0.93 |
| PF02738 | MoCoBD_1 | 0.93 |
| PF00391 | PEP-utilizers | 0.93 |
| PF13374 | TPR_10 | 0.93 |
| PF12697 | Abhydrolase_6 | 0.93 |
| PF01266 | DAO | 0.93 |
| PF01244 | Peptidase_M19 | 0.93 |
| PF13577 | SnoaL_4 | 0.93 |
| PF00702 | Hydrolase | 0.93 |
| PF16925 | TetR_C_13 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 1.85 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.85 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.93 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.93 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.93 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.93 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.93 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.93 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.93 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.63 % |
| Unclassified | root | N/A | 45.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100225786 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10194431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
| 3300004091|Ga0062387_101043409 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300004092|Ga0062389_100060097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3108 | Open in IMG/M |
| 3300004092|Ga0062389_101402923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300004114|Ga0062593_102099038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300005340|Ga0070689_101907807 | Not Available | 542 | Open in IMG/M |
| 3300005471|Ga0070698_100579016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1062 | Open in IMG/M |
| 3300005536|Ga0070697_101164126 | Not Available | 687 | Open in IMG/M |
| 3300005542|Ga0070732_10346794 | Not Available | 893 | Open in IMG/M |
| 3300005598|Ga0066706_11500886 | Not Available | 507 | Open in IMG/M |
| 3300005842|Ga0068858_101266999 | Not Available | 725 | Open in IMG/M |
| 3300005952|Ga0080026_10069130 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300006893|Ga0073928_10021133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6680 | Open in IMG/M |
| 3300007255|Ga0099791_10402333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WYCCWR 12774 | 659 | Open in IMG/M |
| 3300009038|Ga0099829_10361289 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300009176|Ga0105242_11029557 | Not Available | 833 | Open in IMG/M |
| 3300009520|Ga0116214_1319338 | Not Available | 598 | Open in IMG/M |
| 3300010373|Ga0134128_13194944 | Not Available | 503 | Open in IMG/M |
| 3300012202|Ga0137363_10023746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4152 | Open in IMG/M |
| 3300012202|Ga0137363_10365778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
| 3300012924|Ga0137413_10796220 | Not Available | 725 | Open in IMG/M |
| 3300012924|Ga0137413_11465418 | Not Available | 553 | Open in IMG/M |
| 3300012925|Ga0137419_10735022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 803 | Open in IMG/M |
| 3300012951|Ga0164300_10853524 | Not Available | 570 | Open in IMG/M |
| 3300012957|Ga0164303_10045225 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300012960|Ga0164301_10063581 | Not Available | 1966 | Open in IMG/M |
| 3300012961|Ga0164302_10217305 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300013772|Ga0120158_10166713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1195 | Open in IMG/M |
| 3300014168|Ga0181534_10468711 | Not Available | 707 | Open in IMG/M |
| 3300014200|Ga0181526_10315387 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300014201|Ga0181537_11154251 | Not Available | 523 | Open in IMG/M |
| 3300014489|Ga0182018_10389154 | Not Available | 747 | Open in IMG/M |
| 3300014495|Ga0182015_10741156 | Not Available | 618 | Open in IMG/M |
| 3300014501|Ga0182024_10898559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
| 3300015245|Ga0137409_10513763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema ishimotonii | 1022 | Open in IMG/M |
| 3300015371|Ga0132258_10623617 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300016730|Ga0181515_1124103 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300016730|Ga0181515_1363033 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300017937|Ga0187809_10355839 | Not Available | 550 | Open in IMG/M |
| 3300017943|Ga0187819_10503626 | Not Available | 690 | Open in IMG/M |
| 3300017955|Ga0187817_10186818 | Not Available | 1320 | Open in IMG/M |
| 3300017972|Ga0187781_10295692 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300017975|Ga0187782_10221047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1420 | Open in IMG/M |
| 3300018001|Ga0187815_10525262 | Not Available | 508 | Open in IMG/M |
| 3300018062|Ga0187784_11141238 | Not Available | 618 | Open in IMG/M |
| 3300019789|Ga0137408_1078623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1793 | Open in IMG/M |
| 3300020582|Ga0210395_10418518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1008 | Open in IMG/M |
| 3300020582|Ga0210395_11117154 | Not Available | 581 | Open in IMG/M |
| 3300021075|Ga0194063_10196865 | Not Available | 827 | Open in IMG/M |
| 3300021170|Ga0210400_11334122 | Not Available | 574 | Open in IMG/M |
| 3300021181|Ga0210388_10213475 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300021401|Ga0210393_11185314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
| 3300021401|Ga0210393_11592056 | Not Available | 518 | Open in IMG/M |
| 3300021402|Ga0210385_11286675 | Not Available | 560 | Open in IMG/M |
| 3300021407|Ga0210383_10971615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300021420|Ga0210394_11606506 | Not Available | 547 | Open in IMG/M |
| 3300021474|Ga0210390_10116992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila → Catenulispora acidiphila DSM 44928 | 2232 | Open in IMG/M |
| 3300021474|Ga0210390_11007790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 680 | Open in IMG/M |
| 3300021477|Ga0210398_10173519 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300021477|Ga0210398_10182538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1710 | Open in IMG/M |
| 3300022518|Ga0224548_1037531 | Not Available | 534 | Open in IMG/M |
| 3300022557|Ga0212123_10016369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9075 | Open in IMG/M |
| 3300022840|Ga0224549_1050781 | Not Available | 564 | Open in IMG/M |
| 3300023090|Ga0224558_1007573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7205 | Open in IMG/M |
| 3300024176|Ga0224565_1020149 | Not Available | 726 | Open in IMG/M |
| 3300025474|Ga0208479_1029729 | Not Available | 1138 | Open in IMG/M |
| 3300025933|Ga0207706_11252925 | Not Available | 614 | Open in IMG/M |
| 3300025939|Ga0207665_10527732 | Not Available | 915 | Open in IMG/M |
| 3300026281|Ga0209863_10220369 | Not Available | 547 | Open in IMG/M |
| 3300026514|Ga0257168_1082591 | Not Available | 712 | Open in IMG/M |
| 3300026557|Ga0179587_10908332 | Not Available | 580 | Open in IMG/M |
| 3300027061|Ga0209729_1021436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300027072|Ga0208238_1000163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 3152 | Open in IMG/M |
| 3300027334|Ga0209529_1048679 | Not Available | 722 | Open in IMG/M |
| 3300027548|Ga0209523_1005631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2139 | Open in IMG/M |
| 3300027548|Ga0209523_1061976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300027603|Ga0209331_1061404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300027767|Ga0209655_10012369 | All Organisms → cellular organisms → Bacteria | 2885 | Open in IMG/M |
| 3300027853|Ga0209274_10629173 | Not Available | 555 | Open in IMG/M |
| 3300027895|Ga0209624_10717568 | Not Available | 659 | Open in IMG/M |
| 3300028747|Ga0302219_10151623 | Not Available | 888 | Open in IMG/M |
| 3300028789|Ga0302232_10013410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 4825 | Open in IMG/M |
| 3300028808|Ga0302228_10096166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
| 3300029913|Ga0311362_10774473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 801 | Open in IMG/M |
| 3300029943|Ga0311340_10588265 | Not Available | 975 | Open in IMG/M |
| 3300029999|Ga0311339_10759103 | Not Available | 940 | Open in IMG/M |
| 3300030042|Ga0302300_1193832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300030339|Ga0311360_10921737 | Not Available | 691 | Open in IMG/M |
| 3300030490|Ga0302184_10405770 | Not Available | 529 | Open in IMG/M |
| 3300030494|Ga0310037_10292447 | Not Available | 696 | Open in IMG/M |
| 3300030520|Ga0311372_10152119 | All Organisms → cellular organisms → Bacteria | 4005 | Open in IMG/M |
| 3300030580|Ga0311355_11512746 | Not Available | 579 | Open in IMG/M |
| 3300031090|Ga0265760_10059042 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300031231|Ga0170824_109885596 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031525|Ga0302326_10101391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5153 | Open in IMG/M |
| 3300031543|Ga0318516_10401323 | Not Available | 790 | Open in IMG/M |
| 3300031708|Ga0310686_103297654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300031708|Ga0310686_104080135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300031708|Ga0310686_116467072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300031708|Ga0310686_119298565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300031823|Ga0307478_10004103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10481 | Open in IMG/M |
| 3300031823|Ga0307478_10988371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300032001|Ga0306922_10496430 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300032059|Ga0318533_10261898 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300032160|Ga0311301_12288656 | Not Available | 615 | Open in IMG/M |
| 3300033134|Ga0335073_10951051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300033547|Ga0316212_1035648 | Not Available | 701 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.85% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002257862 | 3300002245 | Forest Soil | MPADGTITARIRATAELEGAEQTLDKLHPGGLRGKGIIHL* |
| JGIcombinedJ51221_101944312 | 3300003505 | Forest Soil | VARLLADGTVTARIRSAVGLDAAGQVLDQLRHGGLRGKALIRL* |
| Ga0062387_1010434092 | 3300004091 | Bog Forest Soil | LADGTITARIRSTVDLDAAGQVLEQLRHGGLRGKAVIHL* |
| Ga0062389_1000600972 | 3300004092 | Bog Forest Soil | MLADGTITARIRSTVDLDAAGQVLEQLRHGGLRGKAVIHL* |
| Ga0062389_1014029231 | 3300004092 | Bog Forest Soil | RMLVDGTITARVRSTVGLDGAAGVIEKLHSGGLRGKAVIRL* |
| Ga0062593_1020990382 | 3300004114 | Soil | ARMLADGTITARIRSTVELDGAGPMLEKLRNGGLRGKAVIRL* |
| Ga0070689_1019078071 | 3300005340 | Switchgrass Rhizosphere | MLADGTITARIRSMVELDGAGQLLEQLRNGGLRGKAVIRL* |
| Ga0070698_1005790162 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLASGTITARIGSRVGLDGAGELLETLRKGGLQGKAVIRISP* |
| Ga0070697_1011641262 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LADGTITARIRPMVELDGAGQLLEQLRNGGLRGKAVIRL* |
| Ga0070732_103467942 | 3300005542 | Surface Soil | RMLAGGTITARIQSTVELEGTAQILEKLRSGGLRGKAVIRL* |
| Ga0066706_115008862 | 3300005598 | Soil | ATVAKMLAAATISARVRSVADLAEAGDVLEKLRKGGLRGKAVIRL* |
| Ga0068858_1012669991 | 3300005842 | Switchgrass Rhizosphere | GTITARIRSMVELDGAGQLLEQLRNGGLRGKAVIRL* |
| Ga0080026_100691301 | 3300005952 | Permafrost Soil | LQRVAGLLADGTITARIRSTVGLDGAAQVIEKLRTGGLSGKALIRL* |
| Ga0073928_100211333 | 3300006893 | Iron-Sulfur Acid Spring | MLAGGAITARIRSMVELDGVGQMLEKLRNGGLRGKAVIRL* |
| Ga0099791_104023331 | 3300007255 | Vadose Zone Soil | MIAARIRSTVELDGESQMLEKLHNGGLRGKAVIRL* |
| Ga0099829_103612892 | 3300009038 | Vadose Zone Soil | MLADGTITARIGSTVELDGVAQLLEKLRNGGLRGKAVVRL* |
| Ga0105242_110295571 | 3300009176 | Miscanthus Rhizosphere | MLADGMIAARIRSTVELDGVSQMLEKLHNGVLHGKAVIRL* |
| Ga0116214_13193381 | 3300009520 | Peatlands Soil | TVAQMLADGTITARIRSTVDLDAAGQVLEQLRRGGLRGKAVIRL* |
| Ga0134128_131949442 | 3300010373 | Terrestrial Soil | MIAARIRSTVELDGVSQILEKLHNGGLHGKAVIRL* |
| Ga0137363_100237462 | 3300012202 | Vadose Zone Soil | MIAARVRSTVELDGESQMLEKLHNGGLRGKAVIRL* |
| Ga0137363_103657781 | 3300012202 | Vadose Zone Soil | TITARIRSTVELEAAGQMLDKLRHGALRGKGVIRL* |
| Ga0137413_107962201 | 3300012924 | Vadose Zone Soil | TAMMAARICSTVELDGVSQMLEKLHNGGLRGKAVIRL* |
| Ga0137413_114654181 | 3300012924 | Vadose Zone Soil | TAMMAARICSTVELDGVSQMREKRHIGGVRGNAVIRI* |
| Ga0137419_107350221 | 3300012925 | Vadose Zone Soil | MLAEDMIAARIRSTVELDGEIQMLEKLHNGELRGKAVIRL* |
| Ga0164300_108535241 | 3300012951 | Soil | TVAHMLADGTITARIRSMVELDGAGQLLEQLRNGGLRGKAVIRL* |
| Ga0164303_100452253 | 3300012957 | Soil | MLAHGAITARIRSIVKLGDADQMLEKLRSGGLRGKAVIRL* |
| Ga0164301_100635812 | 3300012960 | Soil | MLAHGAITARIRSMVKLGDAGQMLEKLRSGGLRGKAVIRL* |
| Ga0164302_102173051 | 3300012961 | Soil | MLADGTITARIRSMVELDGAGQTLEQLRNGGLRGKAVIRL* |
| Ga0120158_101667131 | 3300013772 | Permafrost | QLKALGDGTITARIRSMVKLDGAGQLLEQLRNGRLRGKAVIRL* |
| Ga0181534_104687111 | 3300014168 | Bog | LLAAGTITARVRATADLDGAGQILDKLRDGGLRGKAVIRLPDRQGAA* |
| Ga0181526_103153871 | 3300014200 | Bog | MVADGTITTRVSTVVALDGAAQMLATLRQGSLRGKAVIRI* |
| Ga0181537_111542512 | 3300014201 | Bog | GLTEVARMVADGTITARIRSTVDLDGAEQILDKLRNGGLRGKAVIRL* |
| Ga0182018_103891543 | 3300014489 | Palsa | IARMLADGTITARIRSTVELDGAAQIIEKLRSGGLRGKAVIRL* |
| Ga0182015_107411561 | 3300014495 | Palsa | MLANGTITARISATVELDDAAQIIEKVRNGGLRGKAVIHL* |
| Ga0182024_108985591 | 3300014501 | Permafrost | QGLQKVAGMLADGTITARVRSAVGLDGAAQIIEKLRRGGLRGKAVIRL* |
| Ga0137409_105137632 | 3300015245 | Vadose Zone Soil | MLADGTITARISFMFELDDMRQMLEKWRNGGLCGKAVIRL* |
| Ga0132258_106236173 | 3300015371 | Arabidopsis Rhizosphere | MLAVGTITARIRSTVELDGAGPMLEKLRNGGLRGKAVIRL* |
| Ga0181515_11241031 | 3300016730 | Peatland | TARISATVELDRAAQILEKLRNGGLRGKAVIHLQH |
| Ga0181515_13630332 | 3300016730 | Peatland | MLADGTITARVRTTVELEGAGQVLEKLRSGGLSGKAVIRI |
| Ga0187809_103558391 | 3300017937 | Freshwater Sediment | QGLVTVAQMLADGTITARIRSTAGLDAAGQILDELRHGGLRGKAVIRL |
| Ga0187819_105036262 | 3300017943 | Freshwater Sediment | DELPITARIRSTVELDGVSQMLEKLRHGGLRGKAVIRL |
| Ga0187817_101868181 | 3300017955 | Freshwater Sediment | LPITARIRSTVELDGVTQMLEKLRHGGLRGKAVIRV |
| Ga0187781_102956921 | 3300017972 | Tropical Peatland | PQGLVTVAQMLADGTITARIRSAVGLDAAGQVLDELRHGGLRGKAVIRL |
| Ga0187782_102210473 | 3300017975 | Tropical Peatland | PQGLVTVAQMLADRTITARIRSAADLDAAGQVLDELRHGGLRGKAVIRL |
| Ga0187815_105252621 | 3300018001 | Freshwater Sediment | GLATVAQMLADGTITARIGSTVDLDAAGQVLDELRRGGLRGKAIIRL |
| Ga0187784_111412381 | 3300018062 | Tropical Peatland | DRTITARIRSAADLDAAGQVLDELRHGGLRGKAVIRL |
| Ga0137408_10786232 | 3300019789 | Vadose Zone Soil | MIAARIRSTVELDGESQMLEKLHNGGLRGKAVIRL |
| Ga0210395_104185183 | 3300020582 | Soil | TTVAQMLADGMITARIRSTVDLDAAGQVLEQLRRGGLRGKAVIRL |
| Ga0210395_111171542 | 3300020582 | Soil | MLADGTITARIGSTVDLDAAGQVLEELRHGGLHGKAIIRL |
| Ga0194063_101968651 | 3300021075 | Anoxic Zone Freshwater | EGTITTRIHAVVELKGAAQILEKLRNGGLRGKAVIRI |
| Ga0210400_113341221 | 3300021170 | Soil | VVARMLADGTITARIRATVELDGAEQMLDKLRHGGPRCKG |
| Ga0210388_102134753 | 3300021181 | Soil | ATVGQMLSGGTITARIGSTVDLDAAGQVLAELRRGGLRGKAVIRL |
| Ga0210393_111853141 | 3300021401 | Soil | MLADGTITARIRSTVDLDAAGQVLEQLRRGGLRGKAVIRL |
| Ga0210393_115920561 | 3300021401 | Soil | MLADGTITARIRSTVELDGAGQVLGKLRSGGLRGKAVIRL |
| Ga0210385_112866753 | 3300021402 | Soil | DGIITARIQSTVALEAAGQILEKLRKGGLRGKAVIRT |
| Ga0210383_109716152 | 3300021407 | Soil | QMLADETITTRIRSTAGLDAAGQILDELRHGGLRGKAVIRL |
| Ga0210394_116065061 | 3300021420 | Soil | TVAQMLADGTITARIRSTADLDAAGQVLEQLRRGGLRGKAVIRL |
| Ga0210390_101169925 | 3300021474 | Soil | DGTITARIRSTADLDAAGQVLEQLRRGGLRGKAVIRL |
| Ga0210390_110077903 | 3300021474 | Soil | KGLDQIARMLQDGIITARVRTTARLEETGQVIEKLRNGGLSGKAVIRI |
| Ga0210398_101735193 | 3300021477 | Soil | MLSGGTITARIGSTVDLDAAGQVLAELRRGGLRGKAVIRL |
| Ga0210398_101825381 | 3300021477 | Soil | SELARMLVDGTITARIGTTVGLDGAGSVLDQLRRGKVQGKAIIRISPPA |
| Ga0224548_10375312 | 3300022518 | Soil | RMLADGTITARINATVDLNGADQMLEKLRNGDVRGKAVIRL |
| Ga0212123_100163697 | 3300022557 | Iron-Sulfur Acid Spring | MLAGGAITARIRSMVELDGVGQMLEKLRNGGLRGKAVIRL |
| Ga0224549_10507811 | 3300022840 | Soil | KITARIRSTVDLNGVAQTLEKLRNGGLRGKAIIRL |
| Ga0224558_10075738 | 3300023090 | Soil | MLTHGTITARIRSTVELDGAGQTLEKLRNGGLSGKAVIRLLYGCSSSRVK |
| Ga0224565_10201492 | 3300024176 | Plant Litter | MLAEGTITARIGSTVDLDAARQVLEELRHGGLHGKAIIRL |
| Ga0208479_10297291 | 3300025474 | Arctic Peat Soil | QGLSQVARMLADGTITARIRSTVELDAGGQILEKLRNGGLRGKAVIRI |
| Ga0207706_112529251 | 3300025933 | Corn Rhizosphere | MLADGTITARIRSMVELDGAGQLLEQLRNGGLRGKAVIRL |
| Ga0207665_105277322 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLADGMIAARIRSTVELDGVSQMLEKLHNGGLRGKAVIRL |
| Ga0209863_102203691 | 3300026281 | Prmafrost Soil | MLADGTITARIQSTVALEGAGQILETLRTGGLRGKAVIRM |
| Ga0257168_10825911 | 3300026514 | Soil | MLADGTITARIGSTVELDGVAQLLEKLRNGGLRGKAVVRL |
| Ga0179587_109083321 | 3300026557 | Vadose Zone Soil | MLADGTITGRIRSMVELDSAGQMLEELRNGGVRGKA |
| Ga0209729_10214361 | 3300027061 | Forest Soil | MLADGMITARIRSTVELEAAGQMLDKLRHGALRGKGVIRL |
| Ga0208238_10001631 | 3300027072 | Forest Soil | LVTVAQMLADGTITARIRSTTGLDAAAQTLDELRHGGLRGKAVIRL |
| Ga0209529_10486791 | 3300027334 | Forest Soil | PGLTEVARMLADGTITARITSTVDLDGVAQILEKLRQGGLRGKAVIRL |
| Ga0209523_10056313 | 3300027548 | Forest Soil | NEVARMLADGMITARIRSTVEPEAAGQMLDRLRHGALRGKGVIRL |
| Ga0209523_10619762 | 3300027548 | Forest Soil | MLADGMITARIRSTVEPEAAGQMLDKPRHGALRGKGVIRL |
| Ga0209331_10614042 | 3300027603 | Forest Soil | EVAGMLAGGTITARITSMIDLDGAGQLLDKLRKTGLRGKAVIRV |
| Ga0209655_100123695 | 3300027767 | Bog Forest Soil | ADGTITARIGSTTQLDSAGQILDKLRHGGLNGKAVIRP |
| Ga0209274_106291731 | 3300027853 | Soil | ATVAQMLADGTITARISATVDLDAAGQVLDQLRRGGLRGKAVIRL |
| Ga0209624_107175681 | 3300027895 | Forest Soil | DGTITARIRSTVELAAAAQVLDDLRHGGLRGKAVIRL |
| Ga0302219_101516232 | 3300028747 | Palsa | MLAEGTITARIGSTVELAAAAQVLADVGRGRLLGKAVIRL |
| Ga0302232_100134107 | 3300028789 | Palsa | TITARIRSTVELDGAGQILESLRRGGLRGKAVIRL |
| Ga0302228_100961662 | 3300028808 | Palsa | MLAEGTITARIGSTVELAAAAQVLADVGRCRLLGKAVIRL |
| Ga0311362_107744732 | 3300029913 | Bog | GKITARIRSTVELEQAGQTLQNLRKGGLRGKALIRI |
| Ga0311340_105882652 | 3300029943 | Palsa | MLADGTITARIRSTVGLGAAAQVLDDLSRGGLCGKAVIRL |
| Ga0311339_107591031 | 3300029999 | Palsa | LAEIARMLEAGAISARIRSRVGLDGAGQVLEKLRTGGLHGKGVIRLQA |
| Ga0302300_11938321 | 3300030042 | Palsa | GLGEVVRMLADGKITARIRSTVALEGAAQIIEKLRSGGLSGKAVIRL |
| Ga0311360_109217372 | 3300030339 | Bog | LDDGMIAARIYSKVELDGMIQMLEKRHNGGLRGNAVIRL |
| Ga0302184_104057701 | 3300030490 | Palsa | DSTITARIGSTVDLDGAGQVLEDLHHGRLHGKAVIRL |
| Ga0310037_102924471 | 3300030494 | Peatlands Soil | MLAEGTITARVRSTVELDDAGQVLTQLRSGGLRGKAVIRL |
| Ga0311372_101521191 | 3300030520 | Palsa | AEGTITARIGSTVELAAAAQVLADVGRGRLLGKAVIRL |
| Ga0311355_115127461 | 3300030580 | Palsa | TITARIRSTARLDGAAAVLAGLRDGSLRGKAVIRVR |
| Ga0265760_100590421 | 3300031090 | Soil | KITARISATVELDAAAQILEKLRKGGLRGKALIRL |
| Ga0170824_1098855962 | 3300031231 | Forest Soil | RKLTDGAITARISSTVELEGAGKILEQLRSGGLRGKAVIRL |
| Ga0302326_101013911 | 3300031525 | Palsa | EVARMLADGTITARIRSTVELDGAAQILEKLRNGGIRGKAVIRI |
| Ga0318516_104013232 | 3300031543 | Soil | MLADGTITARIRATVDLDGAGQILDSLRKSGLRGKAV |
| Ga0310686_1032976542 | 3300031708 | Soil | ADGTITARIRSTVELDGAEQMLGKLRNGGLRGKGIIHLSEHFRGDI |
| Ga0310686_1040801353 | 3300031708 | Soil | ARMLADGTITARIRSTVELEGVSQMLEELRKGGLRGKAVIRL |
| Ga0310686_1164670721 | 3300031708 | Soil | GLATVAQMLADGIITARIGSTVELAAAAQVLDNLRRGGLRGKALIRL |
| Ga0310686_1192985651 | 3300031708 | Soil | MLASGTITARIRSTVDLEGTAQILEKLRSGGLSGKALIHL |
| Ga0307478_100041038 | 3300031823 | Hardwood Forest Soil | MLADGTISARIRSTVELEAAGQMLDKLRHGALRGKGVIHL |
| Ga0307478_109883711 | 3300031823 | Hardwood Forest Soil | DGTITARIRSTVDLDAAGQVLEQLRRGGLRGKAVIRL |
| Ga0306922_104964302 | 3300032001 | Soil | LTPEGLREIARMLADGTITARIRATVDLDGAGQILDSLRKSGLRGKAVIRL |
| Ga0318533_102618982 | 3300032059 | Soil | MLADGTITARIRATVDLDGAGQILDSLHKSGLRGKAVIRL |
| Ga0311301_122886562 | 3300032160 | Peatlands Soil | LAEGTITARVRSTVELDDAGQVLTQLRSGGLRGKAVIRL |
| Ga0335073_109510512 | 3300033134 | Soil | LNLREVMLADGTITARIRSTVSLDGAGQVLDKLRRGGLRGKAVIRL |
| Ga0316212_10356482 | 3300033547 | Roots | DCAITARIRSTVELDGVAQTLEKLKNGGLRGKAVIHI |
| ⦗Top⦘ |